Q03124 · RSC9_YEAST
- ProteinChromatin structure-remodeling complex subunit RSC9
- GeneRSC9
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids581 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the chromatin structure-remodeling complex (RSC), which is involved in transcription regulation and nucleosome positioning (PubMed:10025404, PubMed:10329629, PubMed:11931764, PubMed:12072455, PubMed:8980231).
RSC is responsible for the transfer of a histone octamer from a nucleosome core particle to naked DNA (PubMed:10025404, PubMed:10329629).
The reaction requires ATP and involves an activated RSC-nucleosome intermediate (PubMed:12183366).
Remodeling reaction also involves DNA translocation, DNA twist and conformational change (PubMed:12183366).
As a reconfigurer of centromeric and flanking nucleosomes, RSC complex is required both for proper kinetochore function in chromosome segregation and, via a PKC1-dependent signaling pathway, for organization of the cellular cytoskeleton (PubMed:12072455, PubMed:12697820).
This subunit plays a role in transcriptional response to stress (PubMed:11931764).
It is involved in both repression and activation of mRNAs regulated by the target of rapamycin (TOR) kinases, and in the synthesis of rRNA (PubMed:10329629, PubMed:11931764).
RSC is responsible for the transfer of a histone octamer from a nucleosome core particle to naked DNA (PubMed:10025404, PubMed:10329629).
The reaction requires ATP and involves an activated RSC-nucleosome intermediate (PubMed:12183366).
Remodeling reaction also involves DNA translocation, DNA twist and conformational change (PubMed:12183366).
As a reconfigurer of centromeric and flanking nucleosomes, RSC complex is required both for proper kinetochore function in chromosome segregation and, via a PKC1-dependent signaling pathway, for organization of the cellular cytoskeleton (PubMed:12072455, PubMed:12697820).
This subunit plays a role in transcriptional response to stress (PubMed:11931764).
It is involved in both repression and activation of mRNAs regulated by the target of rapamycin (TOR) kinases, and in the synthesis of rRNA (PubMed:10329629, PubMed:11931764).
Miscellaneous
Present with 2610 molecules/cell in log phase SD medium.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 395-476 | RFX-type winged-helix | ||||
Sequence: STAWLRCCFEPVQEAEFTQISLWRSYESKFGQPVRESGRKLLPAVEFIKNVSNAFNNAAAIVITDPVTGKKRFVIKGIQPRF |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | RSC-type complex | |
Molecular Function | DNA binding | |
Biological Process | chromatin remodeling | |
Biological Process | nucleosome disassembly | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | rRNA transcription | |
Biological Process | transcription elongation by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameChromatin structure-remodeling complex subunit RSC9
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionQ03124
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes to centromeric and flanking chromatin. Association with these loci is dependent on STH1.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000097475 | 1-581 | Chromatin structure-remodeling complex subunit RSC9 | |||
Sequence: MNSLASNTPLNGTPVSEAPATSSEPVNMFETMVANPIKVSRLQSNGVLTGPAANTKSIHYSLANFNVFQSLPKETARGVDDLTRMEMALLSGIPEEIKWSLKKYLTYSNKAPYMISLRTLPDLLPLFKTFILPLERIVEGLNKSSICDSKAMDSLQMGLNALLILRNLAQDTDSVQILVKDREIKSFILFILKKFQCVATGDNKWQLYEGNATFFNELTHYTLDLMEAISSYIAPAMKDDHYFQTLVSILNYTKDRYMVISILRSLSRLLVRSKANEESAADNLDHKTLSLIVSFLLLECDSELIIASLDFLYQYILPGSQRITELFKSKECSLILEATLPNLLSYNIATPDYHLLQKHKIRLIKRLKPPAPKEPPNLSEDLFQQLFKLNEPLRSTAWLRCCFEPVQEAEFTQISLWRSYESKFGQPVRESGRKLLPAVEFIKNVSNAFNNAAAIVITDPVTGKKRFVIKGIQPRFKALGIADGERESQVPISALKSKFLNDSKEITPARQNSIPEVKFPQELSDVSKVACTFLCLLSNDTDDGAGSAFCQRIRPLVLHKLADIPPLTLALSEYMENTSGL | ||||||
Modified residue | 44 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Component of the two forms of the RSC complex composed of at least either RSC1 or RSC2, and ARP7, ARP9, LDB7, NPL6, RSC3, RSC30, RSC4, RSC58, RSC6, RSC8, RSC9, SFH1, STH1, HTL1 and probably RTT102. The complexes interact with histone and histone variant components of centromeric chromatin.
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-23 | Disordered | ||||
Sequence: MNSLASNTPLNGTPVSEAPATSS |
Sequence similarities
Belongs to the RSC9 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length581
- Mass (Da)65,218
- Last updated1997-11-01 v1
- Checksum04EA7901486656AB
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 60 | in Ref. 3; AA sequence | ||||
Sequence: Y → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z50178 EMBL· GenBank· DDBJ | CAA90556.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006946 EMBL· GenBank· DDBJ | DAA09772.1 EMBL· GenBank· DDBJ | Genomic DNA |