Q02932 · KA120_YEAST
- ProteinImportin beta-like protein KAP120
- GeneKAP120
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1032 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, RAN-dependent mechanism. Required for nuclear import of Ho endonuclease and RFP1, and involved in rRNA-processing and assembly or export of 60S ribosomal subunits.
Miscellaneous
Present with 6300 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | nuclear envelope | |
Cellular Component | nucleus | |
Molecular Function | nuclear import signal receptor activity | |
Molecular Function | nuclear localization sequence binding | |
Molecular Function | small GTPase binding | |
Biological Process | protein import into nucleus |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameImportin beta-like protein KAP120
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionQ02932
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000255954 | 2-1032 | Importin beta-like protein KAP120 | |||
Sequence: ASSLNELNLVQVLEQASNPQHIRSDVQKLAEQQLRQWETQAGFHYLLQSIYLNLSNSLQIRWLAVIQFKNGVDKYWRSTRINAIPKDEKASIRGRLFEMIDEQNNQLCIQNAQASARIARLDFPVEWPTLFEDLENLLNDEIIRKDSVKIYNILMHINQIVKVLGTARIGRCRPAMQSKVPLILPLIVRIYLQSFEEWTTSSNLNYEDLSSLQVSYLALKVLRRIICEGYDRPQTDQSVCDFIKLSVSHFEMLISNHENFKKFDIYEKFIKCLGKLYFNLVTGSPANFILLPCSTQILITYTRLIFDKAPKVYRENSDVTGDFWEQTAIRGLLILKRVINFIHKKGAITLKARSDKLTIDASINKINTEFLNENLITRLVDTLMEWYLRLRPTELENWFMDPEEWINEQMATSYEYQIRPCAENVFQDLMNTFSELLVPYLLKKIENDASKLSNSLDDFLRKDAIYASFQLSASAVSEMVDFDRLLIQVFLPEATNTNISGDELRIIRRRVALIINEWSTVKCSEESKSLCYKLFTNFLTDEDDKVVLLTTVQTVRTMVDDWNFNKDTFQPFLTENVHLLLRKILPSVSLTETRLYVLNTLSDIIIQTKPLISRDLLVEILQIIPNLWEIATNNASEAILANALLRLLRNLVSSLGSQSHLTWDIAIPVVALACDPSSMQYQLLSEDGYELWGMLLQNFSSHDQEFDDKFVELVPFLKYGIETHTEILPTLLEIIKSYALILNPVDFFSNNTFQDIFKQMSKYLLKLREDSFQLVLEIWEILILSNESDYENLLLQKFYETGVLSALFDAIFLEEAPSSYLCSQIIQIIARISYVNPDALMTFLATYHDNLPTSNENARMPESIRKIVSKDQTYDSVVNKLLTGWIVCFRDIFDPKFKKVHILGISSLLRTGLVPILTEFSSIASLWIEMLEEINETNRGDCEKYHLNDIVTEQSIAFHPLTAEQLRYHQLCKNNDPVHNISLKDFISQSMEYLESHLGVERYQEFLKTINPSLLENLQMFLSIQPQEARP |
Keywords
- PTM
Proteomic databases
PTM databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 31-103 | Importin N-terminal | ||||
Sequence: AEQQLRQWETQAGFHYLLQSIYLNLSNSLQIRWLAVIQFKNGVDKYWRSTRINAIPKDEKASIRGRLFEMIDE |
Sequence similarities
Belongs to the importin beta family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,032
- Mass (Da)119,623
- Last updated1996-11-01 v1
- Checksum493EDA2B43298F10
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U43503 EMBL· GenBank· DDBJ | AAB68237.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006949 EMBL· GenBank· DDBJ | DAA11308.1 EMBL· GenBank· DDBJ | Genomic DNA |