Q02858 · TIE2_MOUSE
- ProteinAngiopoietin-1 receptor
- GeneTek
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1122 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Tyrosine-protein kinase that acts as a cell-surface receptor for ANGPT1, ANGPT2 and ANGPT4 and regulates angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Has anti-inflammatory effects by preventing the leakage of pro-inflammatory plasma proteins and leukocytes from blood vessels. Required for normal angiogenesis and heart development during embryogenesis. Required for postnatal hematopoiesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. ANGPT1 signaling triggers receptor dimerization and autophosphorylation at specific tyrosine residues that then serve as binding sites for scaffold proteins and effectors. Signaling is modulated by ANGPT2 that has lower affinity for TEK, can promote TEK autophosphorylation in the absence of ANGPT1, but inhibits ANGPT1-mediated signaling by competing for the same binding site. Signaling is also modulated by formation of heterodimers with TIE1, and by proteolytic processing that gives rise to a soluble TEK extracellular domain. The soluble extracellular domain modulates signaling by functioning as decoy receptor for angiopoietins. TEK phosphorylates DOK2, GRB7, GRB14, PIK3R1, SHC1 and TIE1.
Catalytic activity
- ATP + L-tyrosyl-[protein] = ADP + H+ + O-phospho-L-tyrosyl-[protein]
Activity regulation
Angiopoietin binding leads to receptor dimerization and activation by autophosphorylation at Tyr-990 on the kinase activation loop.
Features
Showing features for binding site, active site.
GO annotations
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAngiopoietin-1 receptor
- EC number
- Alternative names
- CD Antigen Name
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ02858
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Note: Recruited to cell-cell contacts in quiescent endothelial cells. Colocalizes with the actin cytoskeleton and at actin stress fibers during cell spreading. Recruited to the lower surface of migrating cells, especially the rear end of the cell. Proteolytic processing gives rise to a soluble extracellular domain that is secreted (By similarity).
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 23-746 | Extracellular | ||||
Sequence: AMDLILINSLPLVSDAETSLTCIASGWHPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGQAIRIRTMKMRQQASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPDCSRPCTTCKNNGVCHEDTGECICPPGFMGRTCEKACEPHTFGRTCKERCSGPEGCKSYVFCLPDPYGCSCATGWRGLQCNEACPSGYYGPDCKLRCHCTNEEICDRFQGCLCSQGWQGLQCEKEGRPRMTPQIEDLPDHIEVNSGKFNPICKASGWPLPTSEEMTLVKPDGTVLQPNDFNYTDRFSVAIFTVNRVLPPDSGVWVCSVNTVAGMVEKPFNISVKVLPEPLHAPNVIDTGHNFAIINISSEPYFGDGPIKSKKLFYKPVNQAWKYIEVTNEIFTLNYLEPRTDYELCVQLARPGEGGEGHPGPVRRFTTASIGLPPPRGLSLLPKSQTALNLTWQPIFTNSEDEFYVEVERRSLQTTSDQQNIKVPGNLTSVLLSNLVPREQYTVRARVNTKAQGEWSEELRAWTLSDILPPQPENIKISNITDSTAMVSWTIVDGYSISSIIIRYKVQGKNEDQHIDVKIKNATVTQYQLKGLEPETTYHVDIFAENNIGSSNPAFSHELRTLPHSPASADLGGGKML | ||||||
Transmembrane | 747-767 | Helical | ||||
Sequence: LIAILGSAGMTCITVLLAFLI | ||||||
Topological domain | 768-1122 | Cytoplasmic | ||||
Sequence: MLQLKRANVQRRMAQAFQNREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYIAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Embryonically lethal. Embryos die at about 10 dpc, due to strongly decreased numbers of blood vessel endothelial cells, leading to severe hemorrhaging, and due to defects in heart trabeculae development. Mice display a general malformation of the vascular network with defective sprouting and dilated blood vessels. Conditional by inversion allele knockout mice don't have Schlemm's canal. Haploinsufficient mice developed a severely hypomorphic Schlemm's canal with convolutions and focal narrowing (PubMed:27270174).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 853 | Loss of kinase activity. | ||||
Sequence: K → A | ||||||
Mutagenesis | 1100 | Reduced levels of autophosphorylation. Abolishes interaction with GRB2 and GRB7. Abolishes phosphorylation of GRB7 and PIK3R1. | ||||
Sequence: Y → F | ||||||
Mutagenesis | 1106 | Reduced levels of autophosphorylation. | ||||
Sequence: Y → F |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 44 variants from UniProt as well as other sources including ClinVar and dbSNP.
Chemistry
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MDSLAGLVLCGVSLLLYGVVEG | ||||||
Chain | PRO_0000024475 | 23-1122 | Angiopoietin-1 receptor | |||
Sequence: AMDLILINSLPLVSDAETSLTCIASGWHPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGQAIRIRTMKMRQQASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPDCSRPCTTCKNNGVCHEDTGECICPPGFMGRTCEKACEPHTFGRTCKERCSGPEGCKSYVFCLPDPYGCSCATGWRGLQCNEACPSGYYGPDCKLRCHCTNEEICDRFQGCLCSQGWQGLQCEKEGRPRMTPQIEDLPDHIEVNSGKFNPICKASGWPLPTSEEMTLVKPDGTVLQPNDFNYTDRFSVAIFTVNRVLPPDSGVWVCSVNTVAGMVEKPFNISVKVLPEPLHAPNVIDTGHNFAIINISSEPYFGDGPIKSKKLFYKPVNQAWKYIEVTNEIFTLNYLEPRTDYELCVQLARPGEGGEGHPGPVRRFTTASIGLPPPRGLSLLPKSQTALNLTWQPIFTNSEDEFYVEVERRSLQTTSDQQNIKVPGNLTSVLLSNLVPREQYTVRARVNTKAQGEWSEELRAWTLSDILPPQPENIKISNITDSTAMVSWTIVDGYSISSIIIRYKVQGKNEDQHIDVKIKNATVTQYQLKGLEPETTYHVDIFAENNIGSSNPAFSHELRTLPHSPASADLGGGKMLLIAILGSAGMTCITVLLAFLIMLQLKRANVQRRMAQAFQNREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYIAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA | ||||||
Disulfide bond | 44↔102 | |||||
Sequence: CIASGWHPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFC | ||||||
Glycosylation | 140 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 158 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 211↔220 | |||||
Sequence: CEAQKWGPDC | ||||||
Disulfide bond | 224↔233 | |||||
Sequence: CTTCKNNGVC | ||||||
Disulfide bond | 227↔240 | |||||
Sequence: CKNNGVCHEDTGEC | ||||||
Disulfide bond | 242↔251 | |||||
Sequence: CPPGFMGRTC | ||||||
Disulfide bond | 255↔264 | |||||
Sequence: CEPHTFGRTC | ||||||
Disulfide bond | 268↔274 | |||||
Sequence: CSGPEGC | ||||||
Disulfide bond | 280↔287 | |||||
Sequence: CLPDPYGC | ||||||
Disulfide bond | 289↔298 | |||||
Sequence: CATGWRGLQC | ||||||
Disulfide bond | 302↔311 | |||||
Sequence: CPSGYYGPDC | ||||||
Disulfide bond | 315↔323 | |||||
Sequence: CHCTNEEIC | ||||||
Disulfide bond | 317↔329 | |||||
Sequence: CTNEEICDRFQGC | ||||||
Disulfide bond | 331↔340 | |||||
Sequence: CSQGWQGLQC | ||||||
Disulfide bond | 370↔424 | |||||
Sequence: CKASGWPLPTSEEMTLVKPDGTVLQPNDFNYTDRFSVAIFTVNRVLPPDSGVWVC | ||||||
Glycosylation | 399 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 438 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 464 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 558 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 595 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 648 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 690 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 858 | Phosphotyrosine; by autocatalysis | ||||
Sequence: Y | ||||||
Modified residue | 990 | Phosphotyrosine; by autocatalysis | ||||
Sequence: Y | ||||||
Modified residue | 1100 | Phosphotyrosine; by autocatalysis | ||||
Sequence: Y | ||||||
Modified residue | 1106 | Phosphotyrosine; by autocatalysis | ||||
Sequence: Y |
Post-translational modification
Proteolytic processing leads to the shedding of the extracellular domain (soluble TIE-2 alias sTIE-2).
Autophosphorylated on tyrosine residues in response to ligand binding. Autophosphorylation occurs in trans, i.e. one subunit of the dimeric receptor phosphorylates tyrosine residues on the other subunit. Autophosphorylation occurs in a sequential manner, where Tyr-990 in the kinase activation loop is phosphorylated first, followed by autophosphorylation at Tyr-1106 and at additional tyrosine residues. ANGPT1-induced phosphorylation is impaired during hypoxia, due to increased expression of ANGPT2 (By similarity).
Phosphorylation is important for interaction with GRB14, PIK3R1 and PTPN11. Phosphorylation at Tyr-1100 is important for interaction with GRB2 and GRB7. Phosphorylation at Tyr-1106 is important for interaction with DOK2 and for coupling to downstream signal transduction pathways in endothelial cells. Dephosphorylated by PTPRB
Phosphorylation is important for interaction with GRB14, PIK3R1 and PTPN11. Phosphorylation at Tyr-1100 is important for interaction with GRB2 and GRB7. Phosphorylation at Tyr-1106 is important for interaction with DOK2 and for coupling to downstream signal transduction pathways in endothelial cells. Dephosphorylated by PTPRB
Ubiquitinated. The phosphorylated receptor is ubiquitinated and internalized, leading to its degradation (By similarity).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Specifically expressed in developing vascular endothelial cells. Abundantly expressed in lung and heart, moderately in brain, liver and kidney, and weakly in thymus, spleen and testis.
Developmental stage
Expressed in dermal lymphatic endothelial cells at 16.5 and 18.5 dpc (at protein level) (PubMed:28179430).
Expressed in the endocardium, dorsal aorta and maternal decidual blood vessel at 8.5 dpc (PubMed:8415706).
Expressed in the endocardium, dorsal aorta and maternal decidual blood vessel at 8.5 dpc (PubMed:8415706).
Gene expression databases
Interaction
Subunit
Homodimer. Heterodimer with TIE1. Interacts with ANGPT1, ANGPT2 and ANGPT4. At cell-cell contacts in quiescent cells, forms a signaling complex composed of ANGPT1 plus TEK molecules from two adjoining cells. In the absence of endothelial cell-cell contacts, interaction with ANGPT1 mediates contacts with the extracellular matrix. Interacts (tyrosine phosphorylated) with TNIP2. Interacts (tyrosine phosphorylated) with SHC1 (via SH2 domain) (By similarity).
Interacts with PTPRB; this promotes endothelial cell-cell adhesion. Interacts with DOK2, GRB2, GRB7, GRB14, PIK3R1 and PTPN11/SHP2. Colocalizes with DOK2 at contacts with the extracellular matrix in migrating cells
Interacts with PTPRB; this promotes endothelial cell-cell adhesion. Interacts with DOK2, GRB2, GRB7, GRB14, PIK3R1 and PTPN11/SHP2. Colocalizes with DOK2 at contacts with the extracellular matrix in migrating cells
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q02858 | Grb2 Q60631 | 3 | EBI-7099626, EBI-1688 | |
BINARY | Q02858 | Grb7 Q03160 | 3 | EBI-7099626, EBI-7100053 |
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 44-123 | Ig-like C2-type 1 | ||||
Sequence: CIASGWHPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGQAIRIRTMKMRQQAS | ||||||
Domain | 210-252 | EGF-like 1 | ||||
Sequence: RCEAQKWGPDCSRPCTTCKNNGVCHEDTGECICPPGFMGRTCE | ||||||
Domain | 254-299 | EGF-like 2 | ||||
Sequence: ACEPHTFGRTCKERCSGPEGCKSYVFCLPDPYGCSCATGWRGLQCN | ||||||
Domain | 301-341 | EGF-like 3 | ||||
Sequence: ACPSGYYGPDCKLRCHCTNEEICDRFQGCLCSQGWQGLQCE | ||||||
Domain | 350-440 | Ig-like C2-type 2 | ||||
Sequence: PQIEDLPDHIEVNSGKFNPICKASGWPLPTSEEMTLVKPDGTVLQPNDFNYTDRFSVAIFTVNRVLPPDSGVWVCSVNTVAGMVEKPFNIS | ||||||
Domain | 444-539 | Fibronectin type-III 1 | ||||
Sequence: LPEPLHAPNVIDTGHNFAIINISSEPYFGDGPIKSKKLFYKPVNQAWKYIEVTNEIFTLNYLEPRTDYELCVQLARPGEGGEGHPGPVRRFTTASI | ||||||
Domain | 543-635 | Fibronectin type-III 2 | ||||
Sequence: PPRGLSLLPKSQTALNLTWQPIFTNSEDEFYVEVERRSLQTTSDQQNIKVPGNLTSVLLSNLVPREQYTVRARVNTKAQGEWSEELRAWTLSD | ||||||
Domain | 640-733 | Fibronectin type-III 3 | ||||
Sequence: QPENIKISNITDSTAMVSWTIVDGYSISSIIIRYKVQGKNEDQHIDVKIKNATVTQYQLKGLEPETTYHVDIFAENNIGSSNPAFSHELRTLPH | ||||||
Domain | 822-1094 | Protein kinase | ||||
Sequence: IKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYIAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRML |
Domain
The soluble extracellular domain is functionally active in angiopoietin binding and can modulate the activity of the membrane-bound form by competing for angiopoietins.
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length1,122
- Mass (Da)125,701
- Last updated1995-02-01 v2
- ChecksumF879623D103FFE96
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 161-171 | in Ref. 3; BAA02883 | ||||
Sequence: FIHSVPRHEVP → LHPLSAPGMKYL | ||||||
Sequence conflict | 538 | in Ref. 2; CAA47857 | ||||
Sequence: S → C | ||||||
Sequence conflict | 736 | in Ref. 2; CAA47857 and 4; AAB28663 | ||||
Sequence: A → G | ||||||
Sequence conflict | 745-761 | in Ref. 3; BAA02883 | ||||
Sequence: MLLIAILGSAGMTCITV → DATHSHPWVWNDFASPC | ||||||
Sequence conflict | 786 | in Ref. 3; BAA02883 and 6; no nucleotide entry | ||||
Sequence: N → NV | ||||||
Sequence conflict | 913 | in Ref. 3; BAA02883 | ||||
Sequence: R → G | ||||||
Sequence conflict | 925-931 | in Ref. 3; BAA02883 | ||||
Sequence: AIANSTA → CHRQQYS | ||||||
Sequence conflict | 1117 | in Ref. 3; BAA02883 | ||||
Sequence: S → P |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X71426 EMBL· GenBank· DDBJ | CAA50557.1 EMBL· GenBank· DDBJ | mRNA | ||
X67553 EMBL· GenBank· DDBJ | CAA47857.1 EMBL· GenBank· DDBJ | mRNA | ||
D13738 EMBL· GenBank· DDBJ | BAA02883.1 EMBL· GenBank· DDBJ | mRNA | ||
S67051 EMBL· GenBank· DDBJ | AAB28663.1 EMBL· GenBank· DDBJ | mRNA |