Q02241 · KIF23_HUMAN
- ProteinKinesin-like protein KIF23
- GeneKIF23
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids960 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | centralspindlin complex | |
Cellular Component | centrosome | |
Cellular Component | cytosol | |
Cellular Component | Flemming body | |
Cellular Component | focal adhesion | |
Cellular Component | kinesin complex | |
Cellular Component | microtubule | |
Cellular Component | midbody | |
Cellular Component | mitotic spindle | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | spindle | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | microtubule binding | |
Molecular Function | microtubule motor activity | |
Biological Process | microtubule-based movement | |
Biological Process | mitotic cytokinesis | |
Biological Process | mitotic spindle elongation | |
Biological Process | mitotic spindle midzone assembly | |
Biological Process | positive regulation of cytokinesis |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameKinesin-like protein KIF23
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ02241
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Anemia, congenital dyserythropoietic, 3A (CDAN3A)
- Note
- DescriptionAn autosomal dominant blood disorder characterized by ineffective erythropoiesis, hemolytic anemia, macrocytosis in the peripheral blood, intravascular hemolysis, and giant multinucleated erythroblasts in the bone marrow.
- See alsoMIM:105600
Natural variants in CDAN3A
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_086957 | 916 | P>R | in CDAN3A; results in loss of function; does not rescue defective cytokinesis when expressed in KIF3-deficient cells |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_049686 | 515 | in dbSNP:rs17310879 | |||
Sequence: F → L | ||||||
Natural variant | VAR_086957 | 916 | in CDAN3A; results in loss of function; does not rescue defective cytokinesis when expressed in KIF3-deficient cells | |||
Sequence: P → R |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 831 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue, cross-link.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000125434 | 1-960 | UniProt | Kinesin-like protein KIF23 | |||
Sequence: MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPEFADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFDPIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCEILDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLSSNYIAQISNGQQLMSQPQLHRRSNSCSSISVASCISEWEQKIPTYNTPLKVTSIARRRQQEPGQSKTCIVSDRRRGMYWTEGREVVPTFRNEIEIEEDHCGRLLFQPDQNAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQESPNGSRKRRSSTVAPAQPDGAESEWTDVETRCSVAVEMRAGSQLGPGYQHHAQPKRKKP | |||||||
Modified residue (large scale data) | 18 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 56 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 125 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 155 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 155 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 160 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 160 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 303 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 450 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 571 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 582 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Cross-link | 586 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 605 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 605 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 622 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 624 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 647 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 662 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 665 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 682 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 682 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 684 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 684 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 716 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 736 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 738 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 738 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 741 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 814 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 814 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 823 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 854 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 861 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 867 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 867 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 874 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 877 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 889 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 897 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 899 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 902 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 902 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 911 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 911 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 912 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 913 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 924 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 927 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 927 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 943 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 956 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K |
Post-translational modification
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Gene expression databases
Organism-specific databases
Interaction
Subunit
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q02241 | ARF6 P62330 | 23 | EBI-306852, EBI-638181 | |
XENO | Q02241 | Arf6 P62331 | 10 | EBI-306852, EBI-988682 | |
BINARY | Q02241 | BIRC6 Q9NR09 | 4 | EBI-306852, EBI-1765160 | |
BINARY | Q02241 | ECT2 Q9H8V3 | 2 | EBI-306852, EBI-1054039 | |
BINARY | Q02241 | MICAL3 Q7RTP6-1 | 8 | EBI-306852, EBI-13945605 | |
BINARY | Q02241 | RACGAP1 Q9H0H5 | 16 | EBI-306852, EBI-717233 | |
BINARY | Q02241 | SFN P31947 | 4 | EBI-306852, EBI-476295 | |
BINARY | Q02241 | YWHAG P61981 | 8 | EBI-306852, EBI-359832 | |
BINARY | Q02241 | YWHAZ P63104 | 10 | EBI-306852, EBI-347088 |
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, motif, domain, coiled coil, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-20 | Disordered | ||||
Sequence: MKSARAKTPRKPTVKKGSQT | ||||||
Motif | 7-11 | Nuclear localization signal | ||||
Sequence: KTPRK | ||||||
Domain | 25-436 | Kinesin motor | ||||
Sequence: PVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMPNPKTSSSKRQVDPEFADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFDPIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEV | ||||||
Coiled coil | 535-620 | |||||
Sequence: SKENHMQGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTE | ||||||
Compositional bias | 659-680 | Basic and acidic residues | ||||
Sequence: TEPKTEKPERPSRERDREKVTQ | ||||||
Region | 659-691 | Disordered | ||||
Sequence: TEPKTEKPERPSRERDREKVTQRSVSPSPVPLS | ||||||
Region | 794-911 | Interaction with ARF6 | ||||
Sequence: LLFQPDQNAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQESPNGSRKRRS | ||||||
Region | 898-928 | Disordered | ||||
Sequence: LKQESPNGSRKRRSSTVAPAQPDGAESEWTD | ||||||
Region | 941-960 | Disordered | ||||
Sequence: AGSQLGPGYQHHAQPKRKKP |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q02241-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length960
- Mass (Da)110,059
- Last updated2006-11-28 v3
- ChecksumB2AA784D2D236A90
Q02241-2
- Name2
- Differences from canonical
- 690-793: Missing
Q02241-3
- Name3
Computationally mapped potential isoform sequences
There are 6 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A2R8Y531 | A0A2R8Y531_HUMAN | KIF23 | 283 | ||
H0YMJ4 | H0YMJ4_HUMAN | KIF23 | 109 | ||
H0YME6 | H0YME6_HUMAN | KIF23 | 371 | ||
A0A2U3TZL8 | A0A2U3TZL8_HUMAN | KIF23 | 810 | ||
H7BYN4 | H7BYN4_HUMAN | KIF23 | 952 | ||
A0A7I2V5Y5 | A0A7I2V5Y5_HUMAN | KIF23 | 974 |
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_057348 | 1-197 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_057349 | 245 | in isoform 3 | |||
Sequence: K → KWNSCSTPMRNTDFV | ||||||
Compositional bias | 659-680 | Basic and acidic residues | ||||
Sequence: TEPKTEKPERPSRERDREKVTQ | ||||||
Alternative sequence | VSP_021801 | 690-793 | in isoform 2 and isoform 3 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X67155 EMBL· GenBank· DDBJ | CAA47628.2 EMBL· GenBank· DDBJ | mRNA | ||
AK303874 EMBL· GenBank· DDBJ | BAG64812.1 EMBL· GenBank· DDBJ | mRNA | ||
AC027237 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC017705 EMBL· GenBank· DDBJ | AAH17705.2 EMBL· GenBank· DDBJ | mRNA | ||
BC051826 EMBL· GenBank· DDBJ | AAH51826.1 EMBL· GenBank· DDBJ | mRNA |