Q01CH5 · RSSA_OSTTA
- ProteinSmall ribosomal subunit protein uS2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids287 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | 90S preribosome | |
Cellular Component | cytosolic small ribosomal subunit | |
Molecular Function | structural constituent of ribosome | |
Biological Process | cytoplasmic translation | |
Biological Process | ribosomal small subunit assembly |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameSmall ribosomal subunit protein uS2
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Chlorophyta > Mamiellophyceae > Mamiellales > Bathycoccaceae > Ostreococcus
Accessions
- Primary accessionQ01CH5
- Secondary accessions
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000371602 | 1-287 | Small ribosomal subunit protein uS2 | |||
Sequence: MAPQMSQKEADIAMMLAAGCHLGTKNVDFQMERYVWKRRADGIHIINLGKTWDKLMLAARVIVAVENPQDVIAQAARPYGQRAVLKFAQYTGAKALAGRHTPGTYTNQKDAVFAEPRVLVVTDPRTDAQPISETAFVNIPTIAFCDTDSPLKNVDIAIPANNKAKQSIGCLYYLLARMVLQMRGTISPANPWDVMVDLFFYRDPEELEAKEQEEEETAAAAAAPAADAGYNAVADAAYGAESWDDQAGAGFGAQAGNWSEAPAPTGWDAQQGGDFGQGFGAMPPQGY |
Interaction
Subunit
Component of the small ribosomal subunit. Mature ribosomes consist of a small (40S) and a large (60S) subunit. The 40S subunit contains about 33 different proteins and 1 molecule of RNA (18S). The 60S subunit contains about 49 different proteins and 3 molecules of RNA (25S, 5.8S and 5S). Interacts with ribosomal protein S21.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 249-287 | Disordered | ||||
Sequence: AGFGAQAGNWSEAPAPTGWDAQQGGDFGQGFGAMPPQGY |
Sequence similarities
Belongs to the universal ribosomal protein uS2 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length287
- Mass (Da)30,977
- Last updated2009-05-05 v2
- Checksum72CCFC44EE5EADA6
Keywords
- Technical term