Q01768 · NDKB_MOUSE
- ProteinNucleoside diphosphate kinase B
- GeneNme2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids152 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity).
Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically. Binds to both single-stranded guanine- and cytosine-rich strands within the nuclease hypersensitive element (NHE) III1 region of the MYC gene promoter. Does not bind to duplex NHE III1. Has G-quadruplex (G4) DNA-binding activity, which is independent of its nucleotide-binding and kinase activity. Binds both folded and unfolded G4 with similar low nanomolar affinities. Stabilizes folded G4s regardless of whether they are prefolded or not. Exhibits histidine protein kinase activity (By similarity).
Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically. Binds to both single-stranded guanine- and cytosine-rich strands within the nuclease hypersensitive element (NHE) III1 region of the MYC gene promoter. Does not bind to duplex NHE III1. Has G-quadruplex (G4) DNA-binding activity, which is independent of its nucleotide-binding and kinase activity. Binds both folded and unfolded G4 with similar low nanomolar affinities. Stabilizes folded G4s regardless of whether they are prefolded or not. Exhibits histidine protein kinase activity (By similarity).
Catalytic activity
- a 2'-deoxyribonucleoside 5'-diphosphate + ATP = a 2'-deoxyribonucleoside 5'-triphosphate + ADP
Cofactor
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 12 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 60 | ATP (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 88 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 94 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 105 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 115 | ATP (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Active site | 118 | Pros-phosphohistidine intermediate | ||||
Sequence: H |
GO annotations
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNucleoside diphosphate kinase B
- EC number
- Short namesNDK B; NDP kinase B
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ01768
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Colocalizes with ITGB1 and ITGB1BP1 at the edge or peripheral ruffles and lamellipodia during the early stages of cell spreading on fibronectin or collagen but not on vitronectin or laminin substrates.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Impaired activation of the K+ channel Kcnn4, resulting in defective T-cell activation.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 11 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000137118 | 1-152 | Nucleoside diphosphate kinase B | |||
Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIHLWFKPEELIDYKSCAHDWVYE |
Proteomic databases
2D gel databases
PTM databases
Expression
Tissue specificity
Expressed in the base region of the oxyntic and pyloric mucosae.
Gene expression databases
Interaction
Subunit
Hexamer of two different chains: A and B (A6, A5B, A4B2, A3B3, A2B4, AB5, B6) (By similarity).
Interacts with CAPN8 (PubMed:16476741).
Interacts with AKAP13 (By similarity).
Interacts with ITGB1BP1 (via C-terminal domain region) (By similarity).
Interacts with BCL2L10 (PubMed:17532299).
Interacts with CAPN8 (PubMed:16476741).
Interacts with AKAP13 (By similarity).
Interacts with ITGB1BP1 (via C-terminal domain region) (By similarity).
Interacts with BCL2L10 (PubMed:17532299).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q01768 | Itgb1 P09055 | 3 | EBI-642573, EBI-644224 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-66 | Interaction with AKAP13 | ||||
Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVK |
Sequence similarities
Belongs to the NDK family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length152
- Mass (Da)17,363
- Last updated1993-04-01 v1
- Checksum1A5C3F84C1FFC83C
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X68193 EMBL· GenBank· DDBJ | CAA48275.1 EMBL· GenBank· DDBJ | mRNA | ||
AK012447 EMBL· GenBank· DDBJ | BAB28246.1 EMBL· GenBank· DDBJ | mRNA | ||
BC066995 EMBL· GenBank· DDBJ | AAH66995.1 EMBL· GenBank· DDBJ | mRNA | ||
BC086892 EMBL· GenBank· DDBJ | AAH86892.1 EMBL· GenBank· DDBJ | mRNA | ||
BC086893 EMBL· GenBank· DDBJ | AAH86893.1 EMBL· GenBank· DDBJ | mRNA |