Q01295 · BRC1_DROME
- ProteinBroad-complex core protein isoforms 1/2/3/4/5
- Genebr
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids727 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Broad-complex proteins are required for puffing and transcription of salivary gland late genes during metamorphosis.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameBroad-complex core protein isoforms 1/2/3/4/5
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ01295
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000047069 | 1-727 | Broad-complex core protein isoforms 1/2/3/4/5 | |||
Sequence: MDDTQHFCLRWNNYQSSITSAFENLRDDEAFVDVTLACEGRSIKAHRVVLSACSPYFRELLKSTPCKHPVILLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLTQQQAEDTHSHLAQIQNLANSGGRTPLNTHTQSLPHPHHGSLHDDGGSSTLFSRQGAGSPPPTAVPSLPSHINNQLLKRMAMMHRSSAAAAAEETSHAFKRLRGSDNSLPLSGAVGSGSNNNSPDLPPLHARSASPQQTPADFSTIKHHNNNNTPPLKEEKRNGPTGNGNSGNGNGNGNGASNGNGISISDKLGSLTPSPLARAGADDVKSEPMDMVCSNNNANANDEHSNDSTGEHDANRSSSGDGGKGSLSSGNDEEIGDGLASHHAAPQFIMSPAENKMFHAAAFNFPNIDPSALLGLNTQLQQSGDLAVSPQGKLTTNATTTTTTINNSITNNNNNNNNNNYDYSLPTKNSNSQKTPSPTTTTLTTPTTTTPTRPTAITSASGICGLNLSTFAANGSSSGGSNGGLSMTALLPQQQQQQQQQHQMSQQQQQQQQQQQQQGNSSSGQQQQPNGILACSTPKANTPTTTQQQMYAAVMAAAASASASTSGSANSSLNNSNSTLNTSGGLNNSASGGDDFRCNPCNKNLSSLTRLKRHIQNVHMRPTKEPVCNICKRVYSSLNSLRNHKSIYHRNLKQPKQEPGVGATQAAANSFYHQQHQQQQLNHHSSS |
Expression
Induction
Primary response to 20-hydroxyecdysone in third instar larval imaginal disks.
Developmental stage
Isoforms Z1 accumulate slowly in mid instar larvae salivary glands at beginning of ecdysone response (94-114 hours of development at puff stage 1) and become the predominant isoform after 6 hours. Levels diminish at puff stage 2 and are moderately abundant in late larvae from stages 3-10. In prepupae, transcripts appear at puff stage 15 onwards, reaching maximum at stages 18-20. In gut, levels remain constant between stages 1-11. In Malpighian tubules, Z1 isoforms are seen at stages 3 and 7, but not at stage 11. In fat body and wing disks, low levels increase between stages 3 and 11. Isoform Z2 accumulates to a high level at the beginning of the ecdysone response during puff stage 1 and abruptly disappears after several hours. In prepupae, transcripts are reinduced at low levels. Low levels are seen in the Malpighian Tubules, gut and fat body between stages 1-11 and high levels in the wing disk. Isoform Z3; in mid instar larval salivary gland transcript accumulates to a high level at the beginning of the ecdysone response, 94-98 hours of development in puff stage 1, and abruptly disappears after several hours. Levels increase by puff stage 3 remaining abundant in late larvae until stage 10, then diminish by stage 11. In prepupae, transcripts are abundant and increase during puff stages 11-14 and 18-20. High levels are seen in Malpighian tubules, gut and fat body between stages 1-11 and low levels in wing disk.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 32-97 | BTB | ||||
Sequence: VDVTLACEGRSIKAHRVVLSACSPYFRELLKSTPCKHPVILLQDVNFMDLHALVEFIYHGEVNVHQ | ||||||
Compositional bias | 135-151 | Polar residues | ||||
Sequence: NSGGRTPLNTHTQSLPH | ||||||
Region | 135-185 | Disordered | ||||
Sequence: NSGGRTPLNTHTQSLPHPHHGSLHDDGGSSTLFSRQGAGSPPPTAVPSLPS | ||||||
Region | 218-378 | Disordered | ||||
Sequence: RGSDNSLPLSGAVGSGSNNNSPDLPPLHARSASPQQTPADFSTIKHHNNNNTPPLKEEKRNGPTGNGNSGNGNGNGNGASNGNGISISDKLGSLTPSPLARAGADDVKSEPMDMVCSNNNANANDEHSNDSTGEHDANRSSSGDGGKGSLSSGNDEEIGDG | ||||||
Compositional bias | 225-267 | Polar residues | ||||
Sequence: PLSGAVGSGSNNNSPDLPPLHARSASPQQTPADFSTIKHHNNN | ||||||
Compositional bias | 279-310 | Polar residues | ||||
Sequence: GPTGNGNSGNGNGNGNGASNGNGISISDKLGS | ||||||
Compositional bias | 330-344 | Polar residues | ||||
Sequence: DMVCSNNNANANDEH | ||||||
Compositional bias | 352-366 | Polar residues | ||||
Sequence: HDANRSSSGDGGKGS | ||||||
Region | 445-496 | Disordered | ||||
Sequence: INNSITNNNNNNNNNNYDYSLPTKNSNSQKTPSPTTTTLTTPTTTTPTRPTA | ||||||
Region | 532-583 | Disordered | ||||
Sequence: PQQQQQQQQQHQMSQQQQQQQQQQQQQGNSSSGQQQQPNGILACSTPKANTP | ||||||
Region | 604-626 | Disordered | ||||
Sequence: STSGSANSSLNNSNSTLNTSGGL | ||||||
Zinc finger | 636-659 | C2H2-type 1 | ||||
Sequence: FRCNPCNKNLSSLTRLKRHIQNVH | ||||||
Zinc finger | 666-689 | C2H2-type 2 | ||||
Sequence: PVCNICKRVYSSLNSLRNHKSIYH | ||||||
Region | 694-727 | Disordered | ||||
Sequence: QPKQEPGVGATQAAANSFYHQQHQQQQLNHHSSS | ||||||
Compositional bias | 703-727 | Polar residues | ||||
Sequence: ATQAAANSFYHQQHQQQQLNHHSSS |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 6 isoforms produced by Alternative splicing.
Q01295-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsBRCORE-TNT1-Q1-Z1
- Length727
- Mass (Da)77,393
- Last updated2001-02-21 v2
- Checksum97BBA20F3BD734D6
Q01295-2
- Name2
- SynonymsBRCORE-Q1-Z1
- Differences from canonical
- 432-495: Missing
Q01295-3
- Name3
- SynonymsBRCORE-Q2-Z1
- Differences from canonical
- 432-478: Missing
Q01295-4
- Name4
- SynonymsBRCORE-Z2
Q01295-5
- Name5
- SynonymsBRCORE-NS-Z3
- Differences from canonical
- 433-727: KLTTNATTTTTTINNSITNNNNNNNNNNYDYSLPTKNSNSQKTPSPTTTTLTTPTTTTPTRPTAITSASGICGLNLSTFAANGSSSGGSNGGLSMTALLPQQQQQQQQQHQMSQQQQQQQQQQQQQGNSSSGQQQQPNGILACSTPKANTPTTTQQQMYAAVMAAAASASASTSGSANSSLNNSNSTLNTSGGLNNSASGGDDFRCNPCNKNLSSLTRLKRHIQNVHMRPTKEPVCNICKRVYSSLNSLRNHKSIYHRNLKQPKQEPGVGATQAAANSFYHQQHQQQQLNHHSSS → PHSITRSAATSPTSSTSSPPSPPTALISPTSSLKGSLAAAVYSLHSHAHGHVLGHATSPPRPGSVGSSVGSNLCTSTSMGCGVNSGNNSGNNNGNNANNNSNNGNATNNNNNSSSSSTSPGSQATAAGGTVTQAGTPPLPLRMPPPTSGGINEPQECPYCRRTFSCYYSLKRHFQDKHEQSDTLYVCEFCHRRYRTKNSLTTHKSLQHRGSSGMLKRLLKTTAIKHGLVGHGHGHGHVHHPHAHHHALSHPRTSLYDFTSELGQPPPGIQ
Q24206-1
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name6
- SynonymsBRCORE-Z4
Computationally mapped potential isoform sequences
There are 7 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for compositional bias, sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 135-151 | Polar residues | ||||
Sequence: NSGGRTPLNTHTQSLPH | ||||||
Compositional bias | 225-267 | Polar residues | ||||
Sequence: PLSGAVGSGSNNNSPDLPPLHARSASPQQTPADFSTIKHHNNN | ||||||
Sequence conflict | 230 | in Ref. 1; CAA38477/CAA38474/CAA38475 | ||||
Sequence: V → L | ||||||
Compositional bias | 279-310 | Polar residues | ||||
Sequence: GPTGNGNSGNGNGNGNGASNGNGISISDKLGS | ||||||
Compositional bias | 330-344 | Polar residues | ||||
Sequence: DMVCSNNNANANDEH | ||||||
Compositional bias | 352-366 | Polar residues | ||||
Sequence: HDANRSSSGDGGKGS | ||||||
Alternative sequence | VSP_006835 | 432-478 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_006836 | 432-495 | in isoform 2 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_006837 | 433-514 | in isoform 4 | |||
Sequence: KLTTNATTTTTTINNSITNNNNNNNNNNYDYSLPTKNSNSQKTPSPTTTTLTTPTTTTPTRPTAITSASGICGLNLSTFAAN → NSPKKLFSCQLCGKLLCSKASLKRHIADKHAVRQEEYRCAICERVYCSRNSLMTHIYTYHKSRPGEMEMKDIKLYNQFNSSI | ||||||
Alternative sequence | VSP_006839 | 433-727 | in isoform 5 | |||
Sequence: KLTTNATTTTTTINNSITNNNNNNNNNNYDYSLPTKNSNSQKTPSPTTTTLTTPTTTTPTRPTAITSASGICGLNLSTFAANGSSSGGSNGGLSMTALLPQQQQQQQQQHQMSQQQQQQQQQQQQQGNSSSGQQQQPNGILACSTPKANTPTTTQQQMYAAVMAAAASASASTSGSANSSLNNSNSTLNTSGGLNNSASGGDDFRCNPCNKNLSSLTRLKRHIQNVHMRPTKEPVCNICKRVYSSLNSLRNHKSIYHRNLKQPKQEPGVGATQAAANSFYHQQHQQQQLNHHSSS → PHSITRSAATSPTSSTSSPPSPPTALISPTSSLKGSLAAAVYSLHSHAHGHVLGHATSPPRPGSVGSSVGSNLCTSTSMGCGVNSGNNSGNNNGNNANNNSNNGNATNNNNNSSSSSTSPGSQATAAGGTVTQAGTPPLPLRMPPPTSGGINEPQECPYCRRTFSCYYSLKRHFQDKHEQSDTLYVCEFCHRRYRTKNSLTTHKSLQHRGSSGMLKRLLKTTAIKHGLVGHGHGHGHVHHPHAHHHALSHPRTSLYDFTSELGQPPPGIQ | ||||||
Sequence conflict | 457-459 | in Ref. 2 | ||||
Sequence: Missing | ||||||
Sequence conflict | 460 | in Ref. 1; CAA38477 | ||||
Sequence: N → NN | ||||||
Alternative sequence | VSP_006838 | 515-727 | in isoform 4 | |||
Sequence: Missing | ||||||
Compositional bias | 703-727 | Polar residues | ||||
Sequence: ATQAAANSFYHQQHQQQQLNHHSSS |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X54666 EMBL· GenBank· DDBJ | CAA38477.1 EMBL· GenBank· DDBJ | mRNA | ||
X54665 EMBL· GenBank· DDBJ | CAA38476.1 EMBL· GenBank· DDBJ | mRNA | ||
X54663 EMBL· GenBank· DDBJ | CAA38474.1 EMBL· GenBank· DDBJ | mRNA | ||
X54664 EMBL· GenBank· DDBJ | CAA38475.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014298 EMBL· GenBank· DDBJ | AAF45648.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014298 EMBL· GenBank· DDBJ | AAF45651.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014298 EMBL· GenBank· DDBJ | AAN09054.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL009146 EMBL· GenBank· DDBJ | CAA15629.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AL009146 EMBL· GenBank· DDBJ | CAA15626.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL009146 EMBL· GenBank· DDBJ | CAA15628.1 EMBL· GenBank· DDBJ | Genomic DNA |