Q01248 · YSCG_YEREN
- ProteinType 3 secretion system chaperone YscG
- GeneyscG
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids115 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Chaperone of the type III secretion system (T3SS), also called injectisome, which is used to inject bacterial effector proteins into eukaryotic host cells (By similarity).
Along with YscE, prevents premature polymerization of the YscF/SctF needle protein within the cytoplasm (By similarity).
Required for Yop secretion (PubMed:8709853).
Along with YscE, prevents premature polymerization of the YscF/SctF needle protein within the cytoplasm (By similarity).
Required for Yop secretion (PubMed:8709853).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameType 3 secretion system chaperone YscG
- Alternative names
Gene names
Encoded on
- Plasmid pYV
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Yersiniaceae > Yersinia
Accessions
- Primary accessionQ01248
Subcellular Location
UniProt Annotation
GO Annotation
Note: Could be a peripheral membrane protein.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
The yscFG double mutant is unable to secrete the Yop proteins upon thermal induction in a Ca2+-deprived medium.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000066482 | 1-115 | Type 3 secretion system chaperone YscG | |||
Sequence: MKYKLNVLLAEIALIGTGNHCHEEANCIAEWLHLKGEEEAVQLIQLSSLMNRGDYASALQQGNKSTYPDLEPWLALCEYRLGLGNALESRLNRLATSQDPRIQTFVNGMKEQLKT |
Interaction
Subunit
Component of the heterodimeric YscE-YscG chaperone (By similarity).
The YscE-YscG chaperone forms a stable ternary complex with YscF/SctF (By similarity).
The YscE-YscG chaperone forms a stable ternary complex with YscF/SctF (By similarity).
Structure
Sequence
- Sequence statusComplete
- Length115
- Mass (Da)12,930
- Last updated1993-04-01 v1
- Checksum64C2EE2629174EF2
Keywords
- Technical term