Q01247 · SCTF_YEREN
- ProteinType 3 secretion system needle filament protein
- GenesctF
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Component of the type III secretion system (T3SS), also called injectisome, which is used to inject bacterial effector proteins into eukaryotic host cells (PubMed:11287645, PubMed:14580388, PubMed:17697254).
YscF/SctF forms the external needle filament that protrudes from the bacterial surface (PubMed:11287645, PubMed:17697254).
The needle is not sufficient by itself for the formation of a pore allowing translocation of the Yop effectors across the host cell membrane (PubMed:14580388).
YscF/SctF forms the external needle filament that protrudes from the bacterial surface (PubMed:11287645, PubMed:17697254).
The needle is not sufficient by itself for the formation of a pore allowing translocation of the Yop effectors across the host cell membrane (PubMed:14580388).
Activity regulation
The secretion and/or polymerization may be controlled by the type III secretion system regulator YopR.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell surface | |
Cellular Component | extracellular region | |
Cellular Component | type III protein secretion system complex | |
Biological Process | protein secretion by the type III secretion system |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameType 3 secretion system needle filament protein
- Short namesT3SS needle filament protein
- Alternative names
Gene names
Encoded on
- Plasmid pYV
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Yersiniaceae > Yersinia
Accessions
- Primary accessionQ01247
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000066481 | 1-87 | Type 3 secretion system needle filament protein | |||
Sequence: MSNFSGFTKGNDIADLDAVAQTLKKPADDANKAVNDSIAALKDTPDNPALLADLQHSINKWSVIYNISSTIVRSMKDLMQGILQKFP |
Expression
Induction
At 37 degrees Celsius in the absence of calcium.
Interaction
Subunit
The core secretion machinery of the T3SS is composed of approximately 20 different proteins, including cytoplasmic components, a base, an export apparatus and a needle (PubMed:30107569).
This subunit polymerizes and forms the helical needle filament (PubMed:11287645, PubMed:17697254).
In Y.enterocolitica E40, the needles are composed of 139 (plus-minus 19) YscF/SctF subunits (PubMed:17697254).
This subunit polymerizes and forms the helical needle filament (PubMed:11287645, PubMed:17697254).
In Y.enterocolitica E40, the needles are composed of 139 (plus-minus 19) YscF/SctF subunits (PubMed:17697254).
Structure
Sequence
- Sequence statusComplete
- Length87
- Mass (Da)9,449
- Last updated1993-04-01 v1
- Checksum90E78542BB267CF6
Keywords
- Technical term