Q01074 · GP7_BPP22
- ProteinInternal virion protein gp7
- Gene7
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids229 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Inner capsid protein that plays a role in viral DNA ejection into the host cell (PubMed:26245366, PubMed:29590587).
Assembles into an extracellular trans-envelope channel completed by the internal virion proteins gp7 and probably gp16 (PubMed:30886360).
This channel allows the delivery of the viral genome into the cell cytoplasm (PubMed:30886360).
Assembles into an extracellular trans-envelope channel completed by the internal virion proteins gp7 and probably gp16 (PubMed:30886360).
This channel allows the delivery of the viral genome into the cell cytoplasm (PubMed:30886360).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | virion component | |
Biological Process | symbiont genome ejection through host cell envelope, short tail mechanism |
Keywords
- Biological process
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameInternal virion protein gp7
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes > Lederbergvirus
- Virus hosts
Accessions
- Primary accessionQ01074
- Secondary accessions
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for propeptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Propeptide | PRO_0000003374 | 1-20 | Removed in mature form | |||
Sequence: MLYAFTLGRKLRGEEPSYPE | ||||||
Chain | PRO_0000003375 | 21-229 | Internal virion protein gp7 | |||
Sequence: KGGKGGADKSAKYAAEAQKYAADLQNQQFNTIMNNLKPFTPLADKYIGSLEGLSSLEGQGQALNNYYNSQQYQDLAGQARYQNLAAAEATGGLGSTATSNQLSAIAPTLGQQWLSGQMNNYQNLANIGLGALQGQANAGQTYANNMSQISQQSAALAAANANRPSAMQSAIGGGASGAIAGAGLAKLIGSSTPWGAAIGGGIGLLGSLF |
Expression
Keywords
- Developmental stage
Family & Domains
Sequence similarities
Belongs to the podoviruses gp7 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length229
- Mass (Da)23,433
- Last updated2004-03-15 v2
- Checksum92845934DA170627
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 3 | in Ref. 1 and 2 | ||||
Sequence: Y → H |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M93985 EMBL· GenBank· DDBJ | AAA72115.1 EMBL· GenBank· DDBJ | Unassigned DNA | ||
AF217253 EMBL· GenBank· DDBJ | AAF75053.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK000583 EMBL· GenBank· DDBJ | DAA00993.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
L07556 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |