Q01069 · ESMB_DROME
- ProteinEnhancer of split mbeta protein
- GeneE(spl)mbeta-HLH
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids195 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcriptional repressor of genes that require a bHLH protein for their transcription (By similarity).
May serve as a transcriptional regulator of the Achaete-scute complex (AS-C) genes (PubMed:1528887).
Contributes to the neural-epidermal lineage decision during early neurogenesis (PubMed:1427040).
Part of the Notch signaling pathway (PubMed:1427040).
May serve as a transcriptional regulator of the Achaete-scute complex (AS-C) genes (PubMed:1528887).
Contributes to the neural-epidermal lineage decision during early neurogenesis (PubMed:1427040).
Part of the Notch signaling pathway (PubMed:1427040).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameEnhancer of split mbeta protein
- Short namesE(spl)mbeta
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ01069
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 170 | in strain: Oregon-R, NVIII-1, NVIII-18, NVIII-2, NVIII-22, NVIII-24, NVIII-28, NVIII-41, NVIII-42, NVIII-46, NVIII-5, NVIII-9, NVIII-m11, NVIII-m12, NVIII-m13, NVIII-m15 and NVIII-m19 | ||||
Sequence: D → G |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000127176 | 1-195 | Enhancer of split mbeta protein | |||
Sequence: MVLEMEMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKLRAQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHLGHRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTSGPMWRPW |
Proteomic databases
Expression
Developmental stage
In larvae, detected in neuroblasts (at protein level) (PubMed:22357926).
In imaginal disks, expressed as follows: in the eye disk, within and posterior to the morphogenetic furrow; in the wing pouch, in the presumptive intervein regions and wing margin; in the leg disk, general expression (PubMed:1427040).
In imaginal disks, expressed as follows: in the eye disk, within and posterior to the morphogenetic furrow; in the wing pouch, in the presumptive intervein regions and wing margin; in the leg disk, general expression (PubMed:1427040).
Gene expression databases
Interaction
Subunit
Transcription repression requires formation of a complex with a corepressor protein (Groucho).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q01069 | tap O16867 | 3 | EBI-94554, EBI-102737 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 13-70 | bHLH | ||||
Sequence: YRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVEHMKKL | ||||||
Domain | 99-132 | Orange | ||||
Sequence: FRAGYVHAANEVSKTLAAVPGVSVDLGTQLMSHL | ||||||
Region | 163-195 | Disordered | ||||
Sequence: TPPPSECDSLESGACSPAPSEASSTSGPMWRPW | ||||||
Motif | 192-195 | WRPW motif | ||||
Sequence: WRPW |
Domain
Has a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG).
The C-terminal WRPW motif is a transcriptional repression domain necessary for the interaction with Groucho, a transcriptional corepressor recruited to specific target DNA by Hairy-related proteins.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length195
- Mass (Da)21,494
- Last updated2000-12-01 v2
- Checksum8ECAAC7E55D081DC
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 171 | in Ref. 1; AAA28909 | ||||
Sequence: S → T | ||||||
Sequence conflict | 176 | in Ref. 1; AAA28909 | ||||
Sequence: A → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M96166 EMBL· GenBank· DDBJ | AAA28909.1 EMBL· GenBank· DDBJ | mRNA | ||
X67047 EMBL· GenBank· DDBJ | CAA47432.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779906 EMBL· GenBank· DDBJ | AAV59047.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779907 EMBL· GenBank· DDBJ | AAV59059.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779908 EMBL· GenBank· DDBJ | AAV59071.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779909 EMBL· GenBank· DDBJ | AAV59083.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779910 EMBL· GenBank· DDBJ | AAV59095.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779911 EMBL· GenBank· DDBJ | AAV59107.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779912 EMBL· GenBank· DDBJ | AAV59119.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779913 EMBL· GenBank· DDBJ | AAV59131.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779914 EMBL· GenBank· DDBJ | AAV59143.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779915 EMBL· GenBank· DDBJ | AAV59155.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779916 EMBL· GenBank· DDBJ | AAV59167.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779917 EMBL· GenBank· DDBJ | AAV59179.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779918 EMBL· GenBank· DDBJ | AAV59191.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779919 EMBL· GenBank· DDBJ | AAV59203.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779920 EMBL· GenBank· DDBJ | AAV59215.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY779921 EMBL· GenBank· DDBJ | AAV59227.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF56546.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY118723 EMBL· GenBank· DDBJ | AAM50583.1 EMBL· GenBank· DDBJ | mRNA |