P97689 · UT1_RAT
- ProteinUrea transporter 1
- GeneSlc14a1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids384 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Mediates the transport of urea driven by a concentration gradient across the cell membrane (PubMed:8982255).
Mediates the transport of urea across the cell membranes of erythrocytes and the renal inner medullary collecting duct which is critical to the urinary concentrating mechanism (By similarity).
Facilitates water transport in erythrocytes (By similarity).
Mediates the transport of urea across the cell membranes of erythrocytes and the renal inner medullary collecting duct which is critical to the urinary concentrating mechanism (By similarity).
Facilitates water transport in erythrocytes (By similarity).
Catalytic activity
- urea(in) = urea(out)
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 334 | Important for channel permeability | ||||
Sequence: T |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | basolateral plasma membrane | |
Cellular Component | plasma membrane | |
Molecular Function | urea channel activity | |
Molecular Function | urea transmembrane transporter activity | |
Molecular Function | water transmembrane transporter activity | |
Biological Process | establishment of localization in cell | |
Biological Process | transmembrane transport | |
Biological Process | urea transmembrane transport | |
Biological Process | urea transport | |
Biological Process | water transport |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameUrea transporter 1
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionP97689
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Basolateral cell membrane ; Multi-pass membrane protein
Note: Restricted to the basolateral membrane in various portions of the urothelium.
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 61-81 | Helical | ||||
Sequence: ISQVVFVSNPISGILILAGLL | ||||||
Transmembrane | 85-105 | Helical | ||||
Sequence: PWWALCGCVGTVVSTLTALLL | ||||||
Transmembrane | 111-131 | Helical | ||||
Sequence: AIAAGLQGYNATLVGILMAVF | ||||||
Transmembrane | 138-158 | Helical | ||||
Sequence: FWWLIFPVSAMSMTCPVFSSA | ||||||
Transmembrane | 168-188 | Helical | ||||
Sequence: LPVFTLPFNMALSLYLSATGH | ||||||
Transmembrane | 250-270 | Helical | ||||
Sequence: LMCLHAAIGSLLGVIAGLSLA | ||||||
Transmembrane | 279-299 | Helical | ||||
Sequence: GLWGFNSSLACIAIGGMFMAL | ||||||
Transmembrane | 305-325 | Helical | ||||
Sequence: LLALACALFTAYFGACMTHLM | ||||||
Transmembrane | 327-347 | Helical | ||||
Sequence: AVHLPACTWSFCLATLLFLLL |
Keywords
- Cellular component
Phenotypes & Variants
Chemistry
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000410964 | 1-384 | Urea transporter 1 | |||
Sequence: MEDIPTMVKVDRGESQILSCRGRRCGLKVLGYVTGDMKEFANWLKDKPVVLQFMDWILRGISQVVFVSNPISGILILAGLLVQNPWWALCGCVGTVVSTLTALLLSQDRSAIAAGLQGYNATLVGILMAVFSDKGDYFWWLIFPVSAMSMTCPVFSSALSSLFSKWDLPVFTLPFNMALSLYLSATGHYNTFFPSKLFMPVSSVPNITWSELSALELLKSLPVGVGQIYGCDNPWTGAIFLCAILLSSPLMCLHAAIGSLLGVIAGLSLAAPFKDIYSGLWGFNSSLACIAIGGMFMALTWQTHLLALACALFTAYFGACMTHLMAAVHLPACTWSFCLATLLFLLLTTENPNIYRMPLSKVTYSEENRIFYLQNKKRVVDSPL | ||||||
Glycosylation | 206 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in brain, spleen, kidney, testis and lung, with highest levels in brain.
Structure
Family & Domains
Sequence similarities
Belongs to the urea transporter family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P97689-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length384
- Mass (Da)42,034
- Last updated2011-06-28 v2
- Checksum1BBD9E8D60CFD6CA
P97689-2
- Name2
- Differences from canonical
- 1-1: M → MNGQSLSGGTDDSHHDPLWIDPFGNRAGKAAPGGFRRLNLFLAQRWQEQEPEEEMA
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
M0R8C6 | M0R8C6_RAT | Slc14a1 | 404 | ||
A0A8I6A939 | A0A8I6A939_RAT | Slc14a1 | 369 | ||
A0A8I5ZWN6 | A0A8I5ZWN6_RAT | Slc14a1 | 440 | ||
A0A8J8XP37 | A0A8J8XP37_RAT | Slc14a1 | 386 |
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_041576 | 1 | in isoform 2 | |||
Sequence: M → MNGQSLSGGTDDSHHDPLWIDPFGNRAGKAAPGGFRRLNLFLAQRWQEQEPEEEMA | ||||||
Sequence conflict | 25 | in Ref. 1; AAB39937 | ||||
Sequence: C → W | ||||||
Sequence conflict | 47 | in Ref. 1; AAB39937 | ||||
Sequence: K → E | ||||||
Sequence conflict | 50 | in Ref. 1; AAB39937 | ||||
Sequence: V → G | ||||||
Sequence conflict | 180 | in Ref. 1; AAB39937 | ||||
Sequence: S → A | ||||||
Sequence conflict | 266 | in Ref. 1; AAB39937 | ||||
Sequence: G → R | ||||||
Sequence conflict | 325 | in Ref. 1; AAB39937 | ||||
Sequence: M → I | ||||||
Sequence conflict | 339 | in Ref. 1; AAB39937 | ||||
Sequence: L → F | ||||||
Sequence conflict | 378-379 | in Ref. 1; AAB39937 | ||||
Sequence: RV → SA | ||||||
Sequence conflict | 382 | in Ref. 1; AAB39937 | ||||
Sequence: S → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U81518 EMBL· GenBank· DDBJ | AAB39937.1 EMBL· GenBank· DDBJ | mRNA | ||
X98399 EMBL· GenBank· DDBJ | CAA67049.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |