P97441 · ZNT3_MOUSE
- ProteinProbable proton-coupled zinc antiporter SLC30A3
- GeneSlc30a3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids388 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Probable proton-coupled zinc ion antiporter mediating the import of zinc from cytoplasm into synaptic vesicles and participating to cellular zinc ion homeostasis in the brain.
Catalytic activity
- 2 H+(out) + Zn2+(in) = 2 H+(in) + Zn2+(out)
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 108 | Zn2+ (UniProtKB | ChEBI); transported zinc | ||||
Sequence: H | ||||||
Binding site | 112 | Zn2+ (UniProtKB | ChEBI); transported zinc | ||||
Sequence: D | ||||||
Binding site | 238 | Zn2+ (UniProtKB | ChEBI); transported zinc | ||||
Sequence: H | ||||||
Binding site | 242 | Zn2+ (UniProtKB | ChEBI); transported zinc | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | glutamatergic synapse | |
Cellular Component | hippocampal mossy fiber | |
Cellular Component | hippocampal mossy fiber to CA3 synapse | |
Cellular Component | late endosome membrane | |
Cellular Component | lysosomal membrane | |
Cellular Component | microvesicle | |
Cellular Component | neuron projection | |
Cellular Component | plasma membrane | |
Cellular Component | synaptic vesicle membrane | |
Molecular Function | antiporter activity | |
Molecular Function | metal ion binding | |
Molecular Function | zinc ion transmembrane transporter activity | |
Biological Process | detoxification of zinc ion | |
Biological Process | positive regulation of transport | |
Biological Process | response to zinc ion | |
Biological Process | sequestering of zinc ion | |
Biological Process | zinc ion import into lysosome | |
Biological Process | zinc ion import into synaptic vesicle | |
Biological Process | zinc ion transmembrane transport |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameProbable proton-coupled zinc antiporter SLC30A3
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP97441
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane ; Multi-pass membrane protein
Late endosome membrane ; Multi-pass membrane protein
Lysosome membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-75 | Cytoplasmic | ||||
Sequence: MEPSLATGGSETTRLVSARDRSSAGGGLRLKSLFTEPSEPLPEEPKLEGMAFHHCHKDPVPQSGLSPERVQARRQ | ||||||
Transmembrane | 76-96 | Helical | ||||
Sequence: LYAACAVCFIFMAGEVVGGYL | ||||||
Topological domain | 97-105 | Lumenal | ||||
Sequence: AHSLAIMTD | ||||||
Transmembrane | 106-126 | Helical | ||||
Sequence: AAHLLADIGSMLASLFSLWLS | ||||||
Topological domain | 127-145 | Cytoplasmic | ||||
Sequence: TRPATRTMTFGWHRSETLG | ||||||
Transmembrane | 146-166 | Helical | ||||
Sequence: ALASVVSLWIVTGILLYLAFL | ||||||
Topological domain | 167-177 | Lumenal | ||||
Sequence: RLLHSDYHIEA | ||||||
Transmembrane | 178-198 | Helical | ||||
Sequence: GAMLLTASIAVCANLLMAFVL | ||||||
Topological domain | 199-235 | Cytoplasmic | ||||
Sequence: HQTGAPHSHGSTGAEYAPLEEGHGYPMSLGNTSVRAA | ||||||
Transmembrane | 236-256 | Helical | ||||
Sequence: FVHVLGDLLQSFGVLAASILI | ||||||
Topological domain | 257-263 | Lumenal | ||||
Sequence: YFKPQYK | ||||||
Transmembrane | 264-284 | Helical | ||||
Sequence: VADPISTFLFSICALGSTAPT | ||||||
Topological domain | 285-388 | Cytoplasmic | ||||
Sequence: LRDVLLVLMEGAPRSVEFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEPSQA |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Homozygous knockout mice lacking Slc30a3 do not display overt phenotype with morphology, body weight, lifespan, fertility, litter size being normal (PubMed:9990090).
Zinc ions are eliminated from synaptic vesicles in brain of the knockout mice and the overall levels of zinc in brain is decreased (PubMed:9990090).
Zinc ions are eliminated from synaptic vesicles in brain of the knockout mice and the overall levels of zinc in brain is decreased (PubMed:9990090).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 3 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000206097 | 1-388 | Probable proton-coupled zinc antiporter SLC30A3 | |||
Sequence: MEPSLATGGSETTRLVSARDRSSAGGGLRLKSLFTEPSEPLPEEPKLEGMAFHHCHKDPVPQSGLSPERVQARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMTDAAHLLADIGSMLASLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRLLHSDYHIEAGAMLLTASIAVCANLLMAFVLHQTGAPHSHGSTGAEYAPLEEGHGYPMSLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKVADPISTFLFSICALGSTAPTLRDVLLVLMEGAPRSVEFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEPSQA | ||||||
Modified residue | 63 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 66 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expression is restricted to brain (at protein level). In the brain, most abundant in hippocampus and cerebral cortex. The mRNA is also detected in testis, expression being restricted to germ cells and highest in pachytene spermatocytes and round spermatids.
Developmental stage
In brain expression is negligible at birth, then increases linearly, reaching a maximum at about 3 weeks postpartum.
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-19 | Polar residues | ||||
Sequence: MEPSLATGGSETTRLVSAR | ||||||
Region | 1-41 | Disordered | ||||
Sequence: MEPSLATGGSETTRLVSARDRSSAGGGLRLKSLFTEPSEPL |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length388
- Mass (Da)41,824
- Last updated1997-05-01 v1
- Checksum3CCDD0A37074EF41
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-19 | Polar residues | ||||
Sequence: MEPSLATGGSETTRLVSAR |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U76007 EMBL· GenBank· DDBJ | AAB39731.1 EMBL· GenBank· DDBJ | mRNA | ||
U76009 EMBL· GenBank· DDBJ | AAB39733.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
U76008 EMBL· GenBank· DDBJ | AAB39733.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. |