P97369 · NCF4_MOUSE
- ProteinNeutrophil cytosol factor 4
- GeneNcf4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids339 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Component of the NADPH-oxidase, a multicomponent enzyme system responsible for the oxidative burst in which electrons are transported from NADPH to molecular oxygen, generating reactive oxidant intermediates. It may be important for the assembly and/or activation of the NADPH-oxidase complex.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | endosome membrane | |
Cellular Component | membrane | |
Cellular Component | NADPH oxidase complex | |
Molecular Function | phosphatidylinositol-3-phosphate binding | |
Molecular Function | superoxide-generating NADPH oxidase activator activity | |
Biological Process | phagocytosis | |
Biological Process | respiratory burst | |
Biological Process | superoxide anion generation |
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNeutrophil cytosol factor 4
- Short namesNCF-4
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP97369
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endosome membrane ; Peripheral membrane protein
Membrane ; Peripheral membrane protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000096765 | 1-339 | Neutrophil cytosol factor 4 | |||
Sequence: MALAQQLRSESDFEQLPDDVAVSANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFYALQSKLEERFGPESKNSPFTCSLPTLPAKVYMGAKQEIAETRIPALNAYMKNLLSLPVCVLMDPDVRIFFYQSAYDAEQVPQALRRLRPRTRKIKGVSPQGAIMDRMEAPRAEALFDFTGNSKLELSFKAGDVIFLLSKINKDWLEGTSQGATGIFPGSFVKILKDFPEDEDTTNWLRCYFYEDTGKTIKDIAVEEDLSSTPLFKDLLALMRREFQREDIALSYQDAEGDLVRLLSDEDVGLMVKQARGLPSQKRLFPWKLHVTQKDNYSVYNTVP | ||||||
Modified residue | 154 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 315 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Component of an NADPH oxidase complex composed of a heterodimer formed by the membrane proteins CYBA and CYBB and the cytosolic subunits NCF1, NCF2 and NCF4 (By similarity).
Interacts with NCF2 (PubMed:21551061).
Interacts wirh NCF1 (By similarity).
The NCF2-NCF4 complex interacts with GBP7 (via GB1/RHD3-type G domain) (PubMed:21551061).
Interacts with NCF2 (PubMed:21551061).
Interacts wirh NCF1 (By similarity).
The NCF2-NCF4 complex interacts with GBP7 (via GB1/RHD3-type G domain) (PubMed:21551061).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 19-140 | PX | ||||
Sequence: DVAVSANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFYALQSKLEERFGPESKNSPFTCSLPTLPAKVYMGAKQEIAETRIPALNAYMKNLLSLPVCVLMDPDVRIFFYQSAYDA | ||||||
Domain | 170-229 | SH3 | ||||
Sequence: MEAPRAEALFDFTGNSKLELSFKAGDVIFLLSKINKDWLEGTSQGATGIFPGSFVKILKD | ||||||
Domain | 237-329 | PB1 | ||||
Sequence: TNWLRCYFYEDTGKTIKDIAVEEDLSSTPLFKDLLALMRREFQREDIALSYQDAEGDLVRLLSDEDVGLMVKQARGLPSQKRLFPWKLHVTQK |
Domain
The PB1 domain mediates the association with NCF2/p67-PHOX.
The PX domain mediates interaction with membranes enriched in phosphatidylnositol 3-phosphate.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length339
- Mass (Da)38,707
- Last updated2011-07-27 v2
- Checksum62C4B8FC2D2C4CB1
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A8XU21 | A8XU21_MOUSE | Ncf4 | 252 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 85 | in Ref. 1; AAC53122, 2; BAA25651 and 6; AAH25517 | ||||
Sequence: S → N |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U59488 EMBL· GenBank· DDBJ | AAC53122.1 EMBL· GenBank· DDBJ | mRNA | ||
AB002665 EMBL· GenBank· DDBJ | BAA25651.1 EMBL· GenBank· DDBJ | mRNA | ||
AK150510 EMBL· GenBank· DDBJ | BAE29623.1 EMBL· GenBank· DDBJ | mRNA | ||
AK171315 EMBL· GenBank· DDBJ | BAE42387.1 EMBL· GenBank· DDBJ | mRNA | ||
AL589692 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH466545 EMBL· GenBank· DDBJ | EDL29666.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC025517 EMBL· GenBank· DDBJ | AAH25517.1 EMBL· GenBank· DDBJ | mRNA |