P97297 · ADML_MOUSE
- ProteinPro-adrenomedullin
- GeneAdm
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids184 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
AM and PAMP are potent hypotensive and vasodilatator agents.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePro-adrenomedullin
- Cleaved into 2 chains
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP97297
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, peptide, modified residue, propeptide, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MKLVSITLMLLGSLAFLGADT | ||||||
Peptide | PRO_0000000965 | 22-41 | Proadrenomedullin N-20 terminal peptide | |||
Sequence: AGPDTPSQFRKKWNKWALSR | ||||||
Modified residue | 41 | Arginine amide | ||||
Sequence: R | ||||||
Propeptide | PRO_0000000966 | 45-92 | ||||
Sequence: ELQASSSYPTGLADETTVPTQTLDPFLDEQNTTGPLQASNQSEAHIRV | ||||||
Peptide | PRO_0000000967 | 95-144 | Adrenomedullin | |||
Sequence: YRQSMNQGSRSNGCRFGTCTFQKLAHQIYQLTDKDKDGMAPRNKISPQGY | ||||||
Disulfide bond | 108↔113 | |||||
Sequence: CRFGTC | ||||||
Modified residue | 144 | Tyrosine amide | ||||
Sequence: Y | ||||||
Propeptide | PRO_0000000968 | 151-184 | PreproAM C-terminal fragment | |||
Sequence: SLLEVLRSRTVESSQEQTHTAPGPWAHISRLFRI |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 130-149 | Disordered | ||||
Sequence: KDGMAPRNKISPQGYGRRRR |
Sequence similarities
Belongs to the adrenomedullin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length184
- Mass (Da)20,750
- Last updated2011-06-28 v2
- ChecksumC88C9903C479C898
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 173 | in Ref. 1; BAA11367 | ||||
Sequence: G → A |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D78349 EMBL· GenBank· DDBJ | BAA11367.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U77630 EMBL· GenBank· DDBJ | AAB36535.1 EMBL· GenBank· DDBJ | mRNA | ||
AK144181 EMBL· GenBank· DDBJ | BAE25751.1 EMBL· GenBank· DDBJ | mRNA | ||
AK144600 EMBL· GenBank· DDBJ | BAE25959.1 EMBL· GenBank· DDBJ | mRNA | ||
AK144649 EMBL· GenBank· DDBJ | BAE25989.1 EMBL· GenBank· DDBJ | mRNA | ||
AK171066 EMBL· GenBank· DDBJ | BAE42225.1 EMBL· GenBank· DDBJ | mRNA | ||
CH466531 EMBL· GenBank· DDBJ | EDL16987.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC052665 EMBL· GenBank· DDBJ | AAH52665.1 EMBL· GenBank· DDBJ | mRNA |