P96440 · EXPG_RHIME
- ProteinExopolysaccharide II synthesis transcriptional activator ExpG
- GeneexpG
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids194 (go to sequence)
- Protein existencePredicted
- Annotation score3/5
Function
function
Transcriptional activator of genes for galactoglucan synthesis (exopolysaccharide II or EPS II).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameExopolysaccharide II synthesis transcriptional activator ExpG
Gene names
Encoded on
- Plasmid pSymB (megaplasmid 2)
Organism names
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Alphaproteobacteria > Hyphomicrobiales > Rhizobiaceae > Sinorhizobium/Ensifer group > Sinorhizobium
Accessions
- Primary accessionP96440
- Secondary accessions
Proteomes
Phenotypes & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 9 | in strain: EFB1 | ||||
Sequence: I → M | ||||||
Natural variant | 21-22 | in strain: EFB1 | ||||
Sequence: AI → SV | ||||||
Natural variant | 29 | in strain: EFB1 | ||||
Sequence: Q → M | ||||||
Natural variant | 34-40 | in strain: EFB1 | ||||
Sequence: DTPVDDR → ETLAADQ | ||||||
Natural variant | 44 | in strain: EFB1 | ||||
Sequence: D → N | ||||||
Natural variant | 52 | in strain: EFB1 | ||||
Sequence: L → Q | ||||||
Natural variant | 77 | in strain: EFB1 | ||||
Sequence: E → D | ||||||
Natural variant | 92 | in strain: EFB1 | ||||
Sequence: E → D | ||||||
Natural variant | 142 | in strain: EFB1 | ||||
Sequence: E → V | ||||||
Natural variant | 147 | in strain: EFB1 | ||||
Sequence: L → V | ||||||
Natural variant | 153 | in strain: EFB1 | ||||
Sequence: Q → E | ||||||
Natural variant | 166 | in strain: EFB1 | ||||
Sequence: D → E |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 12 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000054353 | 1-194 | Exopolysaccharide II synthesis transcriptional activator ExpG | |||
Sequence: MERGMNHRILYPFADFGDTVAILPANETQRKGLDTPVDDRDGDDSLVTYFELARVMERASRRFSGLLRAELTKLGVEDIGPAQAMVLLAIGEAELSVGELLDRGHYVGSNISYYLKQLADGDYIDRIASQRDKRSARIRLSEKGRQLCAGLRQAAKGYERALSHGDQDRRNLETAFQTLHRLELVWGNAARYGI |
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 49-184 | HTH marR-type | ||||
Sequence: YFELARVMERASRRFSGLLRAELTKLGVEDIGPAQAMVLLAIGEAELSVGELLDRGHYVGSNISYYLKQLADGDYIDRIASQRDKRSARIRLSEKGRQLCAGLRQAAKGYERALSHGDQDRRNLETAFQTLHRLEL |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length194
- Mass (Da)21,785
- Last updated1997-05-01 v1
- ChecksumF8F71B85D819C08D
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U51475 EMBL· GenBank· DDBJ | AAC44137.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
Z79692 EMBL· GenBank· DDBJ | CAB01941.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Y08703 EMBL· GenBank· DDBJ | CAB41454.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL591985 EMBL· GenBank· DDBJ | CAC49293.1 EMBL· GenBank· DDBJ | Genomic DNA |