P93735 · ELIP1_ARATH
- ProteinEarly light-induced protein 1, chloroplastic
- GeneELIP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids195 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Prevents excess accumulation of free chlorophyll by inhibiting the entire chlorophyll biosynthesis pathway (e.g. 5-aminolevulinate synthesis and Mg-protoporphyrin IX chelatase activity), and hence prevent photooxidative stress (By similarity).
Probably involved in the integration of pigments into the mature light-harvesting pigment-protein complexes. Light-harvesting chlorophyll (LHC) a/b-binding protein required to ensure a high rate of chlorophyll accumulation during deetiolation in continuous high light. Involved in seed germination. May fulfill a photoprotective functions
Probably involved in the integration of pigments into the mature light-harvesting pigment-protein complexes. Light-harvesting chlorophyll (LHC) a/b-binding protein required to ensure a high rate of chlorophyll accumulation during deetiolation in continuous high light. Involved in seed germination. May fulfill a photoprotective functions
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | photosystem I | |
Cellular Component | photosystem II | |
Biological Process | cellular response to blue light | |
Biological Process | cellular response to far red light | |
Biological Process | cellular response to heat | |
Biological Process | cellular response to high light intensity | |
Biological Process | cellular response to red light | |
Biological Process | cellular response to UV-A | |
Biological Process | photoprotection | |
Biological Process | photosynthesis | |
Biological Process | positive regulation of seed germination | |
Biological Process | regulation of chlorophyll biosynthetic process | |
Biological Process | response to cold | |
Biological Process | response to light stimulus |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameEarly light-induced protein 1, chloroplastic
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionP93735
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Plastid, chloroplast thylakoid membrane ; Multi-pass membrane protein
Note: Associated with both photosystems I and II (By similarity).
Coisolates equally with monomeric (mLhcb) and trimeric (tLhcb) populations of the major LHC from photosystem II (PSII) in response to 2 hours light stress
Coisolates equally with monomeric (mLhcb) and trimeric (tLhcb) populations of the major LHC from photosystem II (PSII) in response to 2 hours light stress
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 104-124 | Helical | ||||
Sequence: LAMVGFVAALAVELSKGENVL | ||||||
Transmembrane | 131-151 | Helical | ||||
Sequence: GVSWFLGTTAILTLASLVPLF | ||||||
Transmembrane | 175-195 | Helical | ||||
Sequence: FAMLGLVALAFTEFVKGGTLV |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Reduced greening during deetiolation in continuous high light, with a reduced ratio between chlorophylls a and especially at the highest irradiances. Slight reduction in the rate of chlorophyll accumulation during greening at moderate light intensities, and lower zeaxanthin accumulation in high light conditions. Normal sensitivity to photoinhibition and photooxidation. Impaired seed germination, especially in high light conditions and at warm to hot temperatures (greater than 22 degrees Celsius).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 18 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-46 | Chloroplast | ||||
Sequence: MATASFNMQSVFAGGLTTRKINTNKLFSAGSFPNLKRNYPVGVRCM | ||||||
Chain | PRO_0000422364 | 47-195 | Early light-induced protein 1, chloroplastic | |||
Sequence: AEGGPTNEDSSPAPSTSAAQPLPKSPSPPPPMKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKGENVLAQISDGGVSWFLGTTAILTLASLVPLFKGISVESKSKGIMTSDAELWNGRFAMLGLVALAFTEFVKGGTLV |
Proteomic databases
Expression
Induction
Levels increase linearly with increasing light intensities and correlate with the degree of photoinactivation and photodamage of PSII reaction centers (at protein level). Induced by high-intensity light, at both cold and warm temperatures (e.g. 4 and 22 degrees Celsius) (at protein level); quickly and transiently induced during deetiolation, and accumulates in green seedlings following increases in light intensity (PubMed:31604812).
Induced by UV-A, red, far-red and blue lights illumination in a phytochrome A and phytochrome B-dependent manner; this induction is promoted by HY5. The COP9 signalosome is involved in dark-mediated repression. Accumulates upon heat shock. Transcript levels follow a circadian cycle, with highest levels 2 hours after light, without protein accumulation. In light stress-preadapted or senescent leaves exposed to light stress there is a lack of correlation between transcript and protein accumulation; transcripts accumulate in red and yellow leaves exposed to high light, but not proteins
Induced by UV-A, red, far-red and blue lights illumination in a phytochrome A and phytochrome B-dependent manner; this induction is promoted by HY5. The COP9 signalosome is involved in dark-mediated repression. Accumulates upon heat shock. Transcript levels follow a circadian cycle, with highest levels 2 hours after light, without protein accumulation. In light stress-preadapted or senescent leaves exposed to light stress there is a lack of correlation between transcript and protein accumulation; transcripts accumulate in red and yellow leaves exposed to high light, but not proteins
Developmental stage
Appears transiently during greening of etiolated seedlings and disappears before chloroplast development is completed.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 46-81 | Disordered | ||||
Sequence: MAEGGPTNEDSSPAPSTSAAQPLPKSPSPPPPMKPK | ||||||
Compositional bias | 65-81 | Pro residues | ||||
Sequence: AQPLPKSPSPPPPMKPK |
Sequence similarities
Belongs to the ELIP/psbS family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length195
- Mass (Da)20,325
- Last updated1997-05-01 v1
- Checksum519AAB7D271D5551
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 65-81 | Pro residues | ||||
Sequence: AQPLPKSPSPPPPMKPK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U89014 EMBL· GenBank· DDBJ | AAB88391.1 EMBL· GenBank· DDBJ | mRNA | ||
AB022223 EMBL· GenBank· DDBJ | BAB01259.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE76682.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY057560 EMBL· GenBank· DDBJ | AAL09799.1 EMBL· GenBank· DDBJ | mRNA | ||
AY075672 EMBL· GenBank· DDBJ | AAL77679.1 EMBL· GenBank· DDBJ | mRNA | ||
AY097423 EMBL· GenBank· DDBJ | AAM19939.1 EMBL· GenBank· DDBJ | mRNA | ||
AY085317 EMBL· GenBank· DDBJ | AAM62548.1 EMBL· GenBank· DDBJ | mRNA |