P93301 · M450_ARATH
- ProteinUncharacterized mitochondrial protein AtMg00450
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids106 (go to sequence)
- Protein existencePredicted
- Annotation score1/5
Function
Miscellaneous
A stretch of 270 kb of the mitochondrial genome is duplicated within the centromere of chromosome 2 resulting in the duplication of the gene. The expression of the duplicated gene is not demonstrated.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion |
Names & Taxonomy
Protein names
- Recommended nameUncharacterized mitochondrial protein AtMg00450
- Alternative names
Gene names
Encoded on
- Mitochondrion
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionP93301
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000196771 | 1-106 | Uncharacterized mitochondrial protein AtMg00450 | |||
Sequence: MVVTAYPKSSAGMGVTVLPEYLKQSSYEAYSRPYSAFFLSGCTKQERSPLLARRLVDAWLSFHSILMINEEVSDWEQLSDHYTRRSLFKTIAFRNLQREEEYRPGG |
Proteomic databases
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length106
- Mass (Da)12,291
- Last updated1997-05-01 v1
- ChecksumBE028D0A5E0B6ECC
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Y08501 EMBL· GenBank· DDBJ | CAA69730.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK010421 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC007729 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |