P93013 · AGP30_ARATH
- ProteinNon-classical arabinogalactan protein 30
- GeneAGP30
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids239 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Proteoglycan required for the timing of seed germination. May function in the abscisic acid (ABA) response.
Miscellaneous
Over-expression of AGP30 severely affects shoot development.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Biological Process | regulation of root development | |
Biological Process | regulation of seed dormancy process |
Names & Taxonomy
Protein names
- Recommended nameNon-classical arabinogalactan protein 30
- Short namesAtAGP30
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionP93013
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
No visible phenotype under normal growth conditions, but freshly harvested seeds of mutant plants show reduced seed dormancy.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 19 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-24 | |||||
Sequence: MGIIGKSVSLTLFALLCFTSSVFT | ||||||
Chain | PRO_0000432825 | 25-239 | Non-classical arabinogalactan protein 30 | |||
Sequence: LGVNQPGSSDPFHSLPQHLPLPPIKLPTLPPAKAPIKLPAYPPAKAPIKLPTLPPAKAPIKLPTLPPIKPPVLPPVYPPKYNKTLVAVRGVVYCKACKYAGVNNVQGAKPVKDAVVRLVCKNKKNSISETKTDKNGYFMLLAPKTVTNYDIKGCRAFLVKSPDTKCSKVSSLHDGGKGSVLKPVLKPGFSSTIMRWFKYSVYNVGPFAFEPTCPK | ||||||
Glycosylation | 106 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Specifically expressed in root tips.
Developmental stage
Expressed in embryos from the initiation of germination.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence similarities
Belongs to the non-classical AGP family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length239
- Mass (Da)25,761
- Last updated1997-05-01 v1
- Checksum582C132A8B5604C9
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U78721 EMBL· GenBank· DDBJ | AAC69131.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC08885.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT002866 EMBL· GenBank· DDBJ | AAO22683.1 EMBL· GenBank· DDBJ | mRNA | ||
BT020350 EMBL· GenBank· DDBJ | AAV85705.1 EMBL· GenBank· DDBJ | mRNA |