P92532 · RT12_ARATH
- ProteinSmall ribosomal subunit protein uS12m
- GeneRPS12
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids125 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Protein S12 is involved in the translation initiation step.
Miscellaneous
A stretch of 270 kb of the mitochondrial genome is duplicated within the centromere of chromosome 2 resulting in the duplication of the gene. The expression of this duplicated gene (At2g07675) is not demonstrated. It is also probably not RNA edited and therefore differs in all the positions known to be edited.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Cellular Component | ribosome | |
Cellular Component | small ribosomal subunit | |
Molecular Function | structural constituent of ribosome | |
Biological Process | translation |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameSmall ribosomal subunit protein uS12m
- Alternative names
Gene names
Encoded on
- Mitochondrion
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionP92532
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000146433 | 1-125 | Small ribosomal subunit protein uS12m | |||
Sequence: MPTFNQLIRHGREEKRRTDRTRALDKCPQKTGVCLRVSTRTPKKPNSALRKIAKVRLSNRHDIFAYIPGEGHNLQEHSTVLIRGGRVKDLPGVKFHCIRGVKDLMGIPGRRRGRSKYGAEKPKSI |
Proteomic databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length125
- Mass (Da)14,248
- Last updated2001-05-04 v2
- Checksum0C0593BCFA098B06
RNA Editing
Edited at positions 35 49 66 74 90 95
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Y08501 EMBL· GenBank· DDBJ | CAA69838.3 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
JF729200 EMBL· GenBank· DDBJ | AEK01266.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
JF729201 EMBL· GenBank· DDBJ | AEK01295.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
JF729202 EMBL· GenBank· DDBJ | AEK01323.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
BK010421 EMBL· GenBank· DDBJ | DAB41518.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC007143 EMBL· GenBank· DDBJ | AAM15421.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AC007730 EMBL· GenBank· DDBJ | AAM15516.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002685 EMBL· GenBank· DDBJ | AEC06070.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
EF488948 EMBL· GenBank· DDBJ | ABS50660.1 EMBL· GenBank· DDBJ | mRNA | ||
EF488949 EMBL· GenBank· DDBJ | ABS50661.1 EMBL· GenBank· DDBJ | mRNA |