P90978 · U2AF2_CAEEL
- ProteinSplicing factor U2AF 65 kDa subunit
- Geneuaf-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids496 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Necessary for the splicing of pre-mRNA. Binds to the polypyrimidine tract of introns early during spliceosome assembly (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | commitment complex | |
Cellular Component | nuclear speck | |
Cellular Component | nucleoplasm | |
Cellular Component | spliceosomal complex | |
Cellular Component | U2-type prespliceosome | |
Cellular Component | U2AF complex | |
Molecular Function | poly-pyrimidine tract binding | |
Molecular Function | pre-mRNA 3'-splice site binding | |
Biological Process | developmental growth | |
Biological Process | embryo development ending in birth or egg hatching | |
Biological Process | embryonic body morphogenesis | |
Biological Process | germ cell development | |
Biological Process | mRNA 3'-splice site recognition | |
Biological Process | nematode larval development | |
Biological Process | regulation of mRNA splicing, via spliceosome | |
Biological Process | spliceosomal complex assembly |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSplicing factor U2AF 65 kDa subunit
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionP90978
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000081991 | 1-496 | Splicing factor U2AF 65 kDa subunit | |||
Sequence: MSDHQDGMKLEDIERQFLDVAQREGGLEAIQPTTGPLENEENLKSSTGGGGGEDDNDRKKRKRSRSRDRDTRRRSRSRDRGERRGGGGGGDRDRSRSRERRRGGGGRDEPRRRGGDDEARSRREPEPQKPREPKKYRFWDVPPTGFETTTPMEYKNMQAAGQVPRGSVQSAVPVVGPSVTCQSRRLYVGNIPFGCNEEAMLDFFNQQMHLCGLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAGMAFDGINFMGQQLKVRRPRDYQPSQNTFDMNSRMPVSTIVVDSANKIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDSQGNSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLACANQQRHNTNLPNSASAIAGIDLSQGAGRATEILCLMNMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPYEDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDVDKYHNRQF |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-21 | Basic and acidic residues | ||||
Sequence: MSDHQDGMKLEDIERQFLDVA | ||||||
Region | 1-142 | Disordered | ||||
Sequence: MSDHQDGMKLEDIERQFLDVAQREGGLEAIQPTTGPLENEENLKSSTGGGGGEDDNDRKKRKRSRSRDRDTRRRSRSRDRGERRGGGGGGDRDRSRSRERRRGGGGRDEPRRRGGDDEARSRREPEPQKPREPKKYRFWDVP | ||||||
Compositional bias | 72-138 | Basic and acidic residues | ||||
Sequence: RRRSRSRDRGERRGGGGGGDRDRSRSRERRRGGGGRDEPRRRGGDDEARSRREPEPQKPREPKKYRF | ||||||
Domain | 184-266 | RRM 1 | ||||
Sequence: RRLYVGNIPFGCNEEAMLDFFNQQMHLCGLAQAPGNPILLCQINLDKNFAFIEFRSIDETTAGMAFDGINFMGQQLKVRRPRD | ||||||
Domain | 291-368 | RRM 2 | ||||
Sequence: NKIFIGGLPNYLTEDQVKELLCSFGPLKAFSLNVDSQGNSKGYAFAEYLDPTLTDQAIAGLNGMQLGDKQLVVQLACA | ||||||
Domain | 404-488 | RRM 3 | ||||
Sequence: NMVTEDELKADDEYEEILEDVRDECSKYGIVRSLEIPRPYEDHPVPGVGKVFVEFASTSDCQRAQAALTGRKFANRTVVTSYYDV |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing. Experimental confirmation may be lacking for some isoforms.
P90978-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameA
- Length496
- Mass (Da)55,431
- Last updated2000-05-30 v2
- Checksum1A967DE89DC9373C
P90978-2
- NameB
- Differences from canonical
- 1-353: Missing
P90978-3
- NameC
- Differences from canonical
- 57-78: Missing
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-21 | Basic and acidic residues | ||||
Sequence: MSDHQDGMKLEDIERQFLDVA | ||||||
Alternative sequence | VSP_005904 | 1-353 | in isoform B | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_005905 | 57-78 | in isoform C | |||
Sequence: Missing | ||||||
Compositional bias | 72-138 | Basic and acidic residues | ||||
Sequence: RRRSRSRDRGERRGGGGGGDRDRSRSRERRRGGGGRDEPRRRGGDDEARSRREPEPQKPREPKKYRF |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U79157 EMBL· GenBank· DDBJ | AAC26982.1 EMBL· GenBank· DDBJ | mRNA | ||
FO080242 EMBL· GenBank· DDBJ | CCD62278.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FO080242 EMBL· GenBank· DDBJ | CCD62279.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FO080242 EMBL· GenBank· DDBJ | CCD62280.1 EMBL· GenBank· DDBJ | Genomic DNA |