P90917 · RBA1_CAEEL
- ProteinProbable histone-binding protein rba-1
- Generba-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids412 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA (By similarity).
Plays a role in regulating cell cycle progression (PubMed:25446273).
Required to repress the induction of vulval development by Ras signaling. In association with the zinc finger protein ztf-11, negatively regulates the expression of non-neuronal genes during neurogenesis (PubMed:31386623).
Plays a role in regulating cell cycle progression (PubMed:25446273).
Required to repress the induction of vulval development by Ras signaling. In association with the zinc finger protein ztf-11, negatively regulates the expression of non-neuronal genes during neurogenesis (PubMed:31386623).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | ESC/E(Z) complex | |
Cellular Component | nucleus | |
Cellular Component | NuRD complex | |
Molecular Function | histone binding | |
Biological Process | cell fate specification | |
Biological Process | chromatin remodeling | |
Biological Process | nematode male tail tip morphogenesis | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | regulation of neurogenesis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProbable histone-binding protein rba-1
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionP90917
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown results in delayed cell cycle progression.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000051184 | 1-412 | Probable histone-binding protein rba-1 | |||
Sequence: MSEAESCEETSKEHRIWKKNVPYLYDTVVTKEVEWPSLSVQWMPDVTKTENSDSSMHRMIHGTHTCGGVQNHLMISKFTITTDTPEFDDAKWDSEREEFGGYGEGSAAKWDTEIKINHPGEVHRARYMPHNPFIIASRGPSDDVYIFDYTKHPSEPKDTKFRPQLRLKGHEGEGYGMSWSNTREGHLLTAGDDGMICHWDINANQTISGQIVPQSKFKGHSSNAEDVSFHALHNFVFGSVGDDRKLNLWDLRQSKPQLTAVGHTAEVNCITFNPFSEYILATGSVDKTVALWDMRNMRKKMYTLKHHNDEIFQVSFSPHYETVLASSGSDDRVIVWDISKIQDPSSSSAASSDSVPPEVIFIHAGHTGKVADFSWNPNRPWTICSSDEFNALQVWEVSNSLVSSEKWETEMI |
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Binds directly to helix 1 of the histone fold of histone H4, a region that is not accessible when H4 is in chromatin (By similarity).
Interacts with zft-11; the interaction is required to suppress the activation of non-neuronal genes in neurons (PubMed:31386623).
Interacts with zft-11; the interaction is required to suppress the activation of non-neuronal genes in neurons (PubMed:31386623).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 117-157 | WD 1 | ||||
Sequence: NHPGEVHRARYMPHNPFIIASRGPSDDVYIFDYTKHPSEPK | ||||||
Repeat | 169-209 | WD 2 | ||||
Sequence: GHEGEGYGMSWSNTREGHLLTAGDDGMICHWDINANQTISG | ||||||
Repeat | 219-259 | WD 3 | ||||
Sequence: GHSSNAEDVSFHALHNFVFGSVGDDRKLNLWDLRQSKPQLT | ||||||
Repeat | 262-302 | WD 4 | ||||
Sequence: GHTAEVNCITFNPFSEYILATGSVDKTVALWDMRNMRKKMY | ||||||
Repeat | 306-346 | WD 5 | ||||
Sequence: HHNDEIFQVSFSPHYETVLASSGSDDRVIVWDISKIQDPSS | ||||||
Repeat | 365-405 | WD 6 | ||||
Sequence: GHTGKVADFSWNPNRPWTICSSDEFNALQVWEVSNSLVSSE |
Sequence similarities
Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length412
- Mass (Da)46,691
- Last updated1997-05-01 v1
- Checksum7F65FA7F4F2D7772
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284601 EMBL· GenBank· DDBJ | CAB03172.1 EMBL· GenBank· DDBJ | Genomic DNA |