P90916 · LIN53_CAEEL
- ProteinProbable histone-binding protein lin-53
- Genelin-53
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids417 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA (By similarity).
Required for hcp-3 and his-1 stabilization, localization of hcp-3 to centromeres and for proper chromosome segregation (PubMed:25446273, PubMed:26904949).
Synthetic multivulva class B (synMuvB) protein (PubMed:9875852).
SynMuvB proteins are required to repress the induction of vulval development by Ras signaling and probably act by forming the multiprotein DRM complex that represses transcription (PubMed:10704416, PubMed:17075059, PubMed:9875852).
Required for hcp-3 and his-1 stabilization, localization of hcp-3 to centromeres and for proper chromosome segregation (PubMed:25446273, PubMed:26904949).
Synthetic multivulva class B (synMuvB) protein (PubMed:9875852).
SynMuvB proteins are required to repress the induction of vulval development by Ras signaling and probably act by forming the multiprotein DRM complex that represses transcription (PubMed:10704416, PubMed:17075059, PubMed:9875852).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome, centromeric region | |
Cellular Component | DRM complex | |
Cellular Component | ESC/E(Z) complex | |
Cellular Component | nucleus | |
Cellular Component | NuRD complex | |
Cellular Component | transcription repressor complex | |
Molecular Function | histone binding | |
Molecular Function | histone deacetylase binding | |
Biological Process | cell fate specification | |
Biological Process | chromatin organization | |
Biological Process | chromatin remodeling | |
Biological Process | embryo development ending in birth or egg hatching | |
Biological Process | embryonic digestive tract morphogenesis | |
Biological Process | mitochondrial unfolded protein response | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | negative regulation of vulval development | |
Biological Process | nematode male tail tip morphogenesis | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProbable histone-binding protein lin-53
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionP90916
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes to centromeres during metaphase. Requires hcp-3 and knl-2 for nuclear and centromere localization.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Decreased protein levels of DRM complex components including lin-9, lin-37, lin-52 and lin-54 (PubMed:17075059).
Double knockout with the programmed cell death regulator mcd-1 results slow larval growth (PubMed:17237514).
RNAi-mediated knockdown results in embryonic lethality (PubMed:26904949, PubMed:9875852).
RNAi-mediated knockdown leads to a reduction of hcp-3 and his-1 protein levels and to a depletion of hcp-3 on centromeres and a reduction of H3K27me3 levels on metaphase chromosomes (PubMed:26904949).
RNAi-mediated knockdown results in chromosome segregation defects during mitosis (PubMed:25446273, PubMed:26904949).
Double knockout with the programmed cell death regulator mcd-1 results slow larval growth (PubMed:17237514).
RNAi-mediated knockdown results in embryonic lethality (PubMed:26904949, PubMed:9875852).
RNAi-mediated knockdown leads to a reduction of hcp-3 and his-1 protein levels and to a depletion of hcp-3 on centromeres and a reduction of H3K27me3 levels on metaphase chromosomes (PubMed:26904949).
RNAi-mediated knockdown results in chromosome segregation defects during mitosis (PubMed:25446273, PubMed:26904949).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 292 | In semidominant alleles n883 and n2978; causes development of multiple vulvas. | ||||
Sequence: L → F |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000051059 | 1-417 | Probable histone-binding protein lin-53 | |||
Sequence: MATLEDGTSEDRVANDEYKIWKKNTPFLYDLVMTHALEWPSLSVQWLPDVAKDNSDHTIHRLILGTHTSDEQNHLLISKICMPTDDAQFDASRYDTERSEYGGFGAVNGKVEPDIRINHEGEVNRARYMPQKSNIIATKSPHADVYIFDYLKHSAVPRDNTFNPLIRLKGHTKEGYGLSWNPNKEGLILSASDDQTVCHWDINANQNVAGELQAKDVFKGHESVVEDVAWHVLHDGVFGSVGDDKKLLIWDVRTSTPGHCIDAHSAEVNCLAFNPYSEFILATGSADKTVALWDLRNLRMKLHSFESHRDEIFQVQWSPHNETILASSGTDKRLHVWDLSKIGEDQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVVCSVSEDNILQVWQMADNIYNEVDEETPADVVERQQ |
Proteomic databases
Expression
Developmental stage
Ubiquitously expressed in embryos and newly hatched larvae. Expressed in all P(3-8).p vulval precursor cells at the time of vulval induction and until after all cell divisions and vulval morphogenesis are complete.
Gene expression databases
Interaction
Subunit
Binds directly to helix 1 of the histone fold of histone H4, a region that is not accessible when H4 is in chromatin (By similarity).
Probable component of a NuRD-like complex, composed of at least lin-53 and hda-1 (PubMed:17075059).
Interacts with lin-35 (PubMed:9875852).
Interacts with hda-1; the interaction is direct (PubMed:17075059, PubMed:9875852).
Component of the DRM complex, at least composed of lin-9, lin-35, lin-37, lin-52, lin-53, lin-54- dpl-1 and efl-1 (PubMed:17075059).
Interacts with hcp-3 (PubMed:26904949).
Probable component of a NuRD-like complex, composed of at least lin-53 and hda-1 (PubMed:17075059).
Interacts with lin-35 (PubMed:9875852).
Interacts with hda-1; the interaction is direct (PubMed:17075059, PubMed:9875852).
Component of the DRM complex, at least composed of lin-9, lin-35, lin-37, lin-52, lin-53, lin-54- dpl-1 and efl-1 (PubMed:17075059).
Interacts with hcp-3 (PubMed:26904949).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P90916 | lin-37 Q23482 | 5 | EBI-324314, EBI-324325 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 118-158 | WD 1 | ||||
Sequence: NHEGEVNRARYMPQKSNIIATKSPHADVYIFDYLKHSAVPR | ||||||
Repeat | 170-210 | WD 2 | ||||
Sequence: GHTKEGYGLSWNPNKEGLILSASDDQTVCHWDINANQNVAG | ||||||
Repeat | 220-260 | WD 3 | ||||
Sequence: GHESVVEDVAWHVLHDGVFGSVGDDKKLLIWDVRTSTPGHC | ||||||
Repeat | 263-303 | WD 4 | ||||
Sequence: AHSAEVNCLAFNPYSEFILATGSADKTVALWDLRNLRMKLH | ||||||
Repeat | 307-347 | WD 5 | ||||
Sequence: SHRDEIFQVQWSPHNETILASSGTDKRLHVWDLSKIGEDQS | ||||||
Repeat | 364-404 | WD 6 | ||||
Sequence: GHTAKISDFSWNPNEPWVVCSVSEDNILQVWQMADNIYNEV |
Sequence similarities
Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length417
- Mass (Da)47,166
- Last updated2006-02-07 v2
- ChecksumAE388CFB048CE51B
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF116530 EMBL· GenBank· DDBJ | AAD05571.1 EMBL· GenBank· DDBJ | mRNA | ||
Z81097 EMBL· GenBank· DDBJ | CAB03178.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL023833 EMBL· GenBank· DDBJ | CAB03178.1 EMBL· GenBank· DDBJ | Genomic DNA |