P87558 · NP_ADECT
- ProteinPre-histone-like nucleoprotein
- GeneL2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids134 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Plays a role in the inhibition of host immune response within the nucleus. Interacts with cellular nucleosomes and immobilizes the host immune danger signal HMGB1 on chromatin. In turn, prevents HMGB1 release out of the cell and thus decreases inflammation. Also plays a role in the wrapping and condensation of the viral DNA. May also promote viral genome import into the nucleus.
Miscellaneous
All late proteins expressed from the major late promoter are produced by alternative splicing and alternative polyadenylation of the same gene giving rise to non-overlapping ORFs. A leader sequence is present in the N-terminus of all these mRNAs and is recognized by the viral shutoff protein to provide expression although conventional translation via ribosome scanning from the cap has been shut off in the host cell.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 23-24 | Cleavage; by viral protease | ||||
Sequence: GA |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell | |
Cellular Component | host cell nucleolus | |
Cellular Component | viral capsid | |
Molecular Function | DNA binding | |
Biological Process | symbiont entry into host cell | |
Biological Process | viral penetration into host nucleus |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended namePre-histone-like nucleoprotein
- Alternative names
- Cleaved into 1 chains
Gene names
Organism names
- Taxonomic lineageViruses > Varidnaviria > Bamfordvirae > Preplasmiviricota > Tectiliviricetes > Rowavirales > Adenoviridae > Mastadenovirus > Canine mastadenovirus A
- Virus hosts
Accessions
- Primary accessionP87558
Subcellular Location
UniProt Annotation
GO Annotation
Histone-like nucleoprotein
Note: Located inside the capsid in association with the viral DNA (core). Present in about 1070 copies per virion.
Pre-histone-like nucleoprotein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for initiator methionine, propeptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Propeptide | PRO_0000439844 | 2-23 | ||||
Sequence: AILISPTNNTGWGLGTHKLFGG | ||||||
Chain | PRO_0000439843 | 2-134 | Pre-histone-like nucleoprotein | |||
Sequence: AILISPTNNTGWGLGTHKLFGGAKQKSDQHPVYVQAHYRASWGSKGRRRRQGRARGAPLDPKTEAEMVATIDEVARNGPPAARLVLEAARRVGAYNLRRARKLTPAGRAMMAMRARQMVKQAKKRKRRVRFRQ | ||||||
Chain | PRO_0000036592 | 24-134 | Histone-like nucleoprotein | |||
Sequence: AKQKSDQHPVYVQAHYRASWGSKGRRRRQGRARGAPLDPKTEAEMVATIDEVARNGPPAARLVLEAARRVGAYNLRRARKLTPAGRAMMAMRARQMVKQAKKRKRRVRFRQ |
Post-translational modification
Cleaved near the N-terminus by the viral protease during virion maturation to form the mature protein.
Keywords
- PTM
Expression
Induction
Expressed in the late phase of the viral replicative cycle.
Keywords
- Developmental stage
Interaction
Subunit
Interacts with the core-capsid bridging protein; this interaction bridges the virus core to the capsid. Interacts with host NPM1; this interaction might play a role in placing the pre-histone-like nucleoprotein on the viral DNA or regulating viral gene expression. Interacts with host HMGB1; this interaction inhibits host immune response.
Structure
Family & Domains
Features
Showing features for region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 40-62 | Disordered | ||||
Sequence: RASWGSKGRRRRQGRARGAPLDP | ||||||
Motif | 125-134 | Nuclear localization signal | ||||
Sequence: KRKRRVRFRQ |
Sequence similarities
Belongs to the adenoviridae histone-like nucleoprotein family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length134
- Mass (Da)15,085
- Last updated1998-12-15 v2
- ChecksumB70C8CA17A2B13C9