P87553 · DPOL_ADECT
- ProteinDNA polymerase
- GenePOL
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1150 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Eukaryotic-type DNA polymerase involved in viral genomic replication. DNA synthesis is protein primed, and acts in a strand displacement replication. Assembles in complex with viral pTP, DBP, host NFIA and host POU2F1/OCT1 on viral origin of replication. The polymerase covalently transfers dCMP onto pTP, thereby initiating complementary strand synthesis.
Miscellaneous
This DNA polymerase requires a protein as a primer.
Catalytic activity
- a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1)
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell nucleus | |
Molecular Function | 3'-5' exonuclease activity | |
Molecular Function | DNA binding | |
Molecular Function | DNA-directed DNA polymerase activity | |
Molecular Function | nucleotide binding | |
Biological Process | DNA-templated DNA replication | |
Biological Process | viral DNA genome replication |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA polymerase
- EC number
Gene names
Organism names
- Taxonomic lineageViruses > Varidnaviria > Bamfordvirae > Preplasmiviricota > Tectiliviricetes > Rowavirales > Adenoviridae > Mastadenovirus > Canine mastadenovirus A
- Virus hosts
Accessions
- Primary accessionP87553
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000046499 | 1-1150 | DNA polymerase | |||
Sequence: MSLVQGHGTSGLFTEPPNPINQQESSGPSLPAQDAAQAFASSPRAGATSTIVNPPKRKYKGAVVVQRATLSISAVLDNGQCVEIKYHSNLASALTNLCNTNLYDLPACLNRPITAHNLPALIEEAAAPYSLICYYQRGTVRRVEFQAEVPLLSFPLKFLVKQGKVFLIKDISQMQKCEFCGSFFKVTHTCALRRRDFYFHHVAAHSADWWEKISFTPIGAPPNTERLFIVYDVETYTWHGKFGKQLVPFMLVFQLLGDDHLVNVAKTLATEQNWEIWNGKEQDTLYYCITPEKRAIGVKFKKFRDTLQQHIAASLWSHVICQNPQLQEKATTLGLESPEELTPDQLKKFKLKGNPRFIEVYAVGHNITGFDEILLAAQVVSTRAEIPPVFEICRNFMPRAGRLLFNDITYSLPNPSYVPAKSYEHWEQGQVLASDLKSQYIKFMVRDTFSLTHTSLKNAAKAYSLTVSKGCCPYQAVNEFYMLGSYQQDADGFPDLKYWKDQEEYSFNKDLWIKEKKGAYDIIQQTLDYCALDVQVTAQLVNKLIESYQIFIKNSVNLPETSFNVFQRPTISSNSHAIFKQILYKAEKPNTHHLSTILMAPSNEMYEYVRLSIRGGRCYPTYIGVLQEPVFVYDICGMYASALTHPFPAGSPLNPYERALAIKAYEQKMLNHKTISYFDKDLLPGIFTIDADPPAEEFLDVLPPFCSRKGGRLCWTNEPLRGEIATSIDVITLHNRGWKVTLIPDTRTTVFPEWKCLAREYVQLNISAKEEADKSKNQTMRSIAKLLSNALYGSFATKLDNKKTVFSDQIESNIAKEIASGAYVVKSSSYIETDNLCAEIMPEFVVAYPPVNSDVRQLAPPSCSEEDPTKDPLAEAPFMHNFSMTSYHYKPIMFIDAEDDDFCLHTLEKSTPLIANNRYPSQIASFVLAWTRAFVSEWSQFLYENDAGTPLENRVLKSVYGDTDSLFTTMEGYKLMEEKGKKRLKKNGGKLVFDPSNPELTWLVECETQCEKCGSDAYSSESVYLAPKLYALKDTTCPKCHHVGKGKLRAKGHATSTLSYDVLKACYYADMQQGSDVFKTSRMSLRRTLTSVQAHVQPFTVTETTLTRKLRPWKDKTLHALDMHRLIPYSRKHPNPRNTETTWMELQWMT |
Interaction
Subunit
Heterodimer with the terminal protein; this heterodimer binds to bp 9 to 18 of the genome. Forms a complex with viral pTP, DBP and hosts NFIA and POU2F1/OCT1 for initiation of replication.
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-49 | Polar residues | ||||
Sequence: MSLVQGHGTSGLFTEPPNPINQQESSGPSLPAQDAAQAFASSPRAGATS | ||||||
Region | 1-53 | Disordered | ||||
Sequence: MSLVQGHGTSGLFTEPPNPINQQESSGPSLPAQDAAQAFASSPRAGATSTIVN |
Sequence similarities
Belongs to the DNA polymerase type-B family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,150
- Mass (Da)130,460
- Last updated1997-05-01 v1
- Checksum474E0F53705C5873
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-49 | Polar residues | ||||
Sequence: MSLVQGHGTSGLFTEPPNPINQQESSGPSLPAQDAAQAFASSPRAGATS |