P87245 · KMS1_SCHPO
- ProteinKaryogamy meiotic segregation protein 1
- Genekms1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids607 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Has a role in karyogamy, recombination and segregation during meiosis. Although it has been shown to associate with the spindle pole body it is unlikely to be involved in its formation or maintenance.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | interphase microtubule organizing center | |
Cellular Component | meiotic nuclear membrane microtubule tethering complex | |
Cellular Component | mitotic spindle pole body | |
Cellular Component | nuclear membrane | |
Cellular Component | Sad1-Kms1 LINC complex | |
Biological Process | cell division | |
Biological Process | DNA double-strand break attachment to nuclear envelope | |
Biological Process | meiotic telomere clustering |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameKaryogamy meiotic segregation protein 1
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Taphrinomycotina > Schizosaccharomycetes > Schizosaccharomycetales > Schizosaccharomycetaceae > Schizosaccharomyces
Accessions
- Primary accessionP87245
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Associates with the spindle pole body (SPB).
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Cells show a distorted structure of the meiotic prophase nucleus but are able to complete mitosis successfully.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 19 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000084310 | 1-607 | Karyogamy meiotic segregation protein 1 | |||
Sequence: MLNERDFDLIFDSYDFKHEGKVHLSNFLPIINDLQLLHPASAPPLLSEFQKQCTLEFVRQNADLSITKDNFRDVYKKLTENEDDSFANQAEKPSMEQQNSKNSIKEDANEHSVNSAHSKSSSNASPESLNPSQMMSKRLSLPPMSQFTDSDFVNILRTPFAQSTPLNRNTSSRNTEMPLVRKDKPDFSNGHHDLIKQITELQDMLDKARDQARKKSRTVDILEGKVNELTHQLNMADSKYNESKVANNSQNNQIKTLKAQNLNIHKNFQKIQSELIQTNSGLYSTKKELSALQVRYATLLRKFTDQTKKIEELSLAASRSSENENTIRRLALENHELKNSNNQLNNHIDDLTREKHLIALSNNPKGDEFLSPSNLDEMVYSKEVGLSFTQPSVCISIPAVGMRESEELRELEFKCKQQKKTIEECKHISQSLQSSLTAESSRNKELVAGFLMLSEEIGIQKWIIQSLSKMSPTLNDFCRRYDSSMPTYEESSHECTVLSSFSDDETGLMATNTTMNNSSKDFMASQDTVNADNPHFLATKGQPLLLLSVMKSNILRLFYVLFLFACFYGLDYILCAELLQAFLRVVFTFCEHIIILLYGRYELVQPS |
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with mcp1 and sad1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P87245 | mcp6 Q10336 | 2 | EBI-1542265, EBI-1562149 | |
BINARY | P87245 | sad1 Q09825 | 5 | EBI-1542265, EBI-929731 | |
BINARY | P87245 | sif1 O74843 | 3 | EBI-1542265, EBI-1542307 | |
BINARY | P87245 | ufe1 O94531 | 3 | EBI-1542265, EBI-1542297 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 83-135 | Disordered | ||||
Sequence: DDSFANQAEKPSMEQQNSKNSIKEDANEHSVNSAHSKSSSNASPESLNPSQMM | ||||||
Compositional bias | 114-135 | Polar residues | ||||
Sequence: NSAHSKSSSNASPESLNPSQMM |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length607
- Mass (Da)69,241
- Last updated1997-07-01 v1
- Checksum216A1D5CA93C9550
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 114-135 | Polar residues | ||||
Sequence: NSAHSKSSSNASPESLNPSQMM |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D84439 EMBL· GenBank· DDBJ | BAA20460.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CU329670 EMBL· GenBank· DDBJ | CAB16381.1 EMBL· GenBank· DDBJ | Genomic DNA |