P87033 · GPA2_USTMA
- ProteinGuanine nucleotide-binding protein alpha-2 subunit
- GeneGPA2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids356 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 43-50 | GTP (UniProtKB | ChEBI) | ||||
Sequence: GAGESGKS | ||||||
Binding site | 50 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 178-184 | GTP (UniProtKB | ChEBI) | ||||
Sequence: LRCRNKT | ||||||
Binding site | 184 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 203-207 | GTP (UniProtKB | ChEBI) | ||||
Sequence: DVGGQ | ||||||
Binding site | 272-275 | GTP (UniProtKB | ChEBI) | ||||
Sequence: NKVD | ||||||
Binding site | 329 | GTP (UniProtKB | ChEBI) | ||||
Sequence: A |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cortical dynamic polarity patch | |
Cellular Component | cytoplasm | |
Cellular Component | heterotrimeric G-protein complex | |
Molecular Function | G protein-coupled receptor binding | |
Molecular Function | G-protein beta/gamma-subunit complex binding | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Molecular Function | metal ion binding | |
Biological Process | G protein-coupled receptor signaling pathway | |
Biological Process | negative regulation of MAPK cascade | |
Biological Process | pheromone response MAPK cascade | |
Biological Process | pheromone-dependent signal transduction involved in conjugation with cellular fusion |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Recommended nameGuanine nucleotide-binding protein alpha-2 subunit
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Basidiomycota > Ustilaginomycotina > Ustilaginomycetes > Ustilaginales > Ustilaginaceae > Ustilago
Accessions
- Primary accessionP87033
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Miscellaneous
PTM/Processing
Features
Showing features for initiator methionine, lipidation, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Lipidation | 2 | N-myristoyl glycine | ||||
Sequence: G | ||||||
Chain | PRO_0000203613 | 2-356 | Guanine nucleotide-binding protein alpha-2 subunit | |||
Sequence: GACLSAEQSHDTPEYKRSKALDRRIKEDEKNLSREVKLLLLGAGESGKSTILKSMRIIHHIPFTDEERENFRRLVFLNLVQGMKTILDVMEEWSIDFQDDSNIDHLLLFVSYPDISEDEPFPTNYLVALKDLWLDQGVQSVYRRGNEAAVPDNMSYYYTDLDRLFSPSYIPSEDDILRCRNKTTGIIETTFPLQDHVYRIFDVGGQRSERKKWIHCFENVTAVLFCVALSGYDSCLVEDKDSNQMQEALMLFDSICNSKWFARTSMILFLNKVDVFRQKIAYSSIKHYFPDYDGDDQDFNAARSYFKARFCRLNRSVNKEIYPSFTNATDVSLLKIVMASVTDIILTNNLRDIVL | ||||||
Lipidation | 4 | S-palmitoyl cysteine | ||||
Sequence: C |
Keywords
- PTM
Interaction
Subunit
G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 35-356 | G-alpha | ||||
Sequence: REVKLLLLGAGESGKSTILKSMRIIHHIPFTDEERENFRRLVFLNLVQGMKTILDVMEEWSIDFQDDSNIDHLLLFVSYPDISEDEPFPTNYLVALKDLWLDQGVQSVYRRGNEAAVPDNMSYYYTDLDRLFSPSYIPSEDDILRCRNKTTGIIETTFPLQDHVYRIFDVGGQRSERKKWIHCFENVTAVLFCVALSGYDSCLVEDKDSNQMQEALMLFDSICNSKWFARTSMILFLNKVDVFRQKIAYSSIKHYFPDYDGDDQDFNAARSYFKARFCRLNRSVNKEIYPSFTNATDVSLLKIVMASVTDIILTNNLRDIVL | ||||||
Region | 38-51 | G1 motif | ||||
Sequence: KLLLLGAGESGKST | ||||||
Region | 176-184 | G2 motif | ||||
Sequence: DILRCRNKT | ||||||
Region | 199-208 | G3 motif | ||||
Sequence: YRIFDVGGQR | ||||||
Region | 268-275 | G4 motif | ||||
Sequence: ILFLNKVD | ||||||
Region | 327-332 | G5 motif | ||||
Sequence: TNATDV |
Sequence similarities
Belongs to the G-alpha family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length356
- Mass (Da)41,307
- Last updated1997-07-01 v1
- Checksum817259B8CEAD1A79
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U85776 EMBL· GenBank· DDBJ | AAC49725.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM003145 EMBL· GenBank· DDBJ | KIS69166.1 EMBL· GenBank· DDBJ | Genomic DNA |