P85857 · GDF6A_DANRE
- ProteinGrowth/differentiation factor 6-A
- Genegdf6a
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids404 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Growth factor that controls proliferation and cellular differentiation in the retina. Plays a key role in regulating apoptosis during retinal development. Establishes dorsal-ventral positional information in the retina and controls the formation of the retinotectal map. Functions maternally in dorsal/ventral patterning to induce the expression of the zygotic bmp2b and bmp4 genes and ventralize embryos. Zygotic expression does not appear to regulate axis specification, but instead functions to establish the integrity of the axial vessels during embryonic development. May be involved in maintaining the identity of cells of the dorsal-most neural tube and of at least a subset of neural crest cells.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGrowth/differentiation factor 6-A
- Short namesGDF-6-A
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionP85857
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Adults display microphthalmia, with eyes obscured by overgrown skin and misshapen irides. Mutants at 2 weeks of age show profound alterations in the morphology of individual photoreceptor subtypes and UV cones. At later timepoints loss of normal retinal lamination is observed, together with a disorganization of Mueller glia cells. Adults, cone photoreceptors are dysmorphic and reduced in abundance.
PTM/Processing
Features
Showing features for signal, propeptide, glycosylation, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-24 | |||||
Sequence: MDALRAVAFYALFVFLWSLPCCQS | ||||||
Propeptide | PRO_0000342703 | 25-284 | ||||
Sequence: AALISQKRSKGARSAFDGQRSHKFLKEILASSPGASRRDDFKDPVVPHDYMISIYRTYSAAEKLGLNASFFRSSKSANTITSFVDKGKDDLTLSPLRRQTYLFDVSTLSDKEELVGAELRIFRKSPGDVQPSPSGVYNLHLLSCRSERPLASRSIDLQDSRKAEWEVLDVWGIFKHRHQENQLCLQLKVTYGKSDTEIDLKQLGFHRHSRTQQERAILVVYTRSKKRENLFNEMKEKIKSRGDDDEEESALQFKARRRRR | ||||||
Glycosylation | 91 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Chain | PRO_0000342704 | 285-404 | Growth/differentiation factor 6-A | |||
Sequence: TALNNRHGKRHGKKSKSRCSKKALHVNFKELGWDDWIIAPLDYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPNSTPPSCCVPTKLSPISILYIDSGNNVVYKQYEDMVVEQCGCR | ||||||
Disulfide bond | 303↔369 | |||||
Sequence: CSKKALHVNFKELGWDDWIIAPLDYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPNSTPPSCC | ||||||
Disulfide bond | 332↔401 | |||||
Sequence: CEGVCDFPLRSHLEPTNHAIIQTLMNSMDPNSTPPSCCVPTKLSPISILYIDSGNNVVYKQYEDMVVEQC | ||||||
Disulfide bond | 336↔403 | |||||
Sequence: CDFPLRSHLEPTNHAIIQTLMNSMDPNSTPPSCCVPTKLSPISILYIDSGNNVVYKQYEDMVVEQCGC | ||||||
Disulfide bond | 368 | Interchain | ||||
Sequence: C |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
First expressed in late gastrula stage embryos (9.5 hours post fertilization (hpf)) in anterior neuroectoderm corresponding to the future dorsal part of the brain. Shortly after tailbud formation (11 hpf), expression expands to the entire neural region and is subsequently expressed in derivatives of the lateral neural plate and migrating neural crest cells, with the future midbrain and hindbrain showing strong expression. Also expressed weakly and transiently in the posterior embryo from 11.5 hpf to 15 hpf in the lateral mesoderm, and in ectoderm above the neural keel. At 14 hpf, expressed along the entire length of the embryo and starting around the 16-somite stage, expressed in the dorsal quadrant of the retina, representing the distal tip of the eye anlage. At this stage, also expressed in the hatching gland and the hypochord. At 24 hpf, expressed in the roof plate outlining the fourth brain ventricle, in the posterior hypochord, the primitive gut endoderm, the ventral tail mesenchyme, the dorsal part of the neural tube and the dorsal fin. Weakly expressed in the dorsal part of the posterior spinal cord and in blood cell precursors.
Developmental stage
Expressed both maternally and zygotically. Expressed from early cleavage stage until blastula sphere stage. Expression is then barely detectable until the end of gastrulation (tailbud stage) when expression is resumed.
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 263-279 | Basic and acidic residues | ||||
Sequence: KSRGDDDEEESALQFKA | ||||||
Region | 263-304 | Disordered | ||||
Sequence: KSRGDDDEEESALQFKARRRRRTALNNRHGKRHGKKSKSRCS | ||||||
Compositional bias | 280-304 | Basic residues | ||||
Sequence: RRRRRTALNNRHGKRHGKKSKSRCS |
Sequence similarities
Belongs to the TGF-beta family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length404
- Mass (Da)46,290
- Last updated2008-07-01 v1
- Checksum23233847DF96E197
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 51 | in Ref. 2; no nucleotide entry | ||||
Sequence: E → R | ||||||
Sequence conflict | 70 | in Ref. 2; no nucleotide entry | ||||
Sequence: V → L | ||||||
Compositional bias | 263-279 | Basic and acidic residues | ||||
Sequence: KSRGDDDEEESALQFKA | ||||||
Compositional bias | 280-304 | Basic residues | ||||
Sequence: RRRRRTALNNRHGKRHGKKSKSRCS |
Keywords
- Technical term