P84347 · MEX2_JACME
- ProteinChymomexicain
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids215 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
function
Cysteine protease.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 25 | |||||
Sequence: C | ||||||
Active site | 160 | |||||
Sequence: H | ||||||
Active site | 176 | |||||
Sequence: N |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Cellular Component | lysosome | |
Molecular Function | cysteine-type endopeptidase activity | |
Biological Process | proteolysis involved in protein catabolic process |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameChymomexicain
- EC number
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Caricaceae > Jacaratia
Accessions
- Primary accessionP84347
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain, signal, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000050557 | ?-215 | Chymomexicain | |||
Sequence: YPESIDWRDKGAVTPVKNQNPCGSCWAFSTVATVEGINKIRTGKLISLSEQELLDCDRRSHGCKGGYQTGSIQYVADNGGVHTEKEYPYEKKQGKCRAKEKKGTKVQITGYKRVPANDEISLIQGIGNQPVSVLHESKGRAFQLYKGGIFNGPCGYKNDHAVTAIGYGKAQLLDKNSWGPNWGEKGYIKIKRASGKSEGTCGVYKSSYFPIKGYR | ||||||
Signal | 1-? | |||||
Disulfide bond | 22↔63 | |||||
Sequence: CGSCWAFSTVATVEGINKIRTGKLISLSEQELLDCDRRSHGC | ||||||
Disulfide bond | 56↔96 | |||||
Sequence: CDRRSHGCKGGYQTGSIQYVADNGGVHTEKEYPYEKKQGKC | ||||||
Disulfide bond | 154↔201 | |||||
Sequence: CGYKNDHAVTAIGYGKAQLLDKNSWGPNWGEKGYIKIKRASGKSEGTC |
Keywords
- PTM
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length215
- Mass (Da)23,666
- Last updated2005-02-15 v1
- Checksum0B4603A661CCE735
Keywords
- Technical term