P83560 · TXMG4_MACGS
- ProteinDelta-hexatoxin-Mg1a
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids105 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Selectively slows channel inactivation of mammalian Nav1.1/SCN1A, Nav1.3/SCN3A, and Nav1.6/SCN8A and shows higher affinity for insect Nav1/para channels (site 3). Induces tonic repetitive firing of nerve impulses in insect neurons accompanied by plateau potentials.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | sodium channel inhibitor activity | |
Molecular Function | toxin activity |
Keywords
- Molecular function
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameDelta-hexatoxin-Mg1a
- Short namesDelta-HXTX-Mg1a
- Alternative names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Chelicerata > Arachnida > Araneae > Mygalomorphae > Macrothelidae > Macrothele
Accessions
- Primary accessionP83560
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Toxic dose
LD50 0.15 pmol/g by intracranial injection into mice.
LD50 is 1.2 nmol/kg in lepidopteran larvae.
PTM/Processing
Features
Showing features for signal, propeptide, disulfide bond, peptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-18 | |||||
Sequence: MKTLVIACVALVLVVVHG | ||||||
Propeptide | PRO_0000035529 | 19-60 | ||||
Sequence: EVIEEVNEKQLQESVEEKYSLLQRLEKLDEAITAEENRNSRV | ||||||
Disulfide bond | 63↔77 | |||||
Sequence: CGSKRAWCKEKKDCC | ||||||
Peptide | PRO_0000035530 | 63-105 | Delta-hexatoxin-Mg1a | |||
Sequence: CGSKRAWCKEKKDCCCGYNCVYAWYNQQSSCERKWKYLFTGEC | ||||||
Disulfide bond | 70↔82 | |||||
Sequence: CKEKKDCCCGYNC | ||||||
Disulfide bond | 76↔93 | |||||
Sequence: CCCGYNCVYAWYNQQSSC | ||||||
Disulfide bond | 78↔105 | |||||
Sequence: CGYNCVYAWYNQQSSCERKWKYLFTGEC |
Keywords
- PTM
Expression
Tissue specificity
Expressed by the venom gland.
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length105
- Mass (Da)12,289
- Last updated2003-08-22 v2
- Checksum0DDBC59A6102C9A1
Mass Spectrometry
Keywords
- Technical term