P83351 · SNA29_CAEEL
- ProteinSoluble NSF attachment protein 29
- Genesnap-29
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids277 (go to sequence)
- Protein existenceInferred from homology
- Annotation score5/5
Function
function
SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. Plays a role in the processing and secretion of the aspartic protease hrg-7 from the intestine (PubMed:28581477).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apical plasma membrane | |
Cellular Component | neuron projection | |
Cellular Component | plasma membrane | |
Cellular Component | presynapse | |
Cellular Component | recycling endosome | |
Cellular Component | SNARE complex | |
Molecular Function | SNAP receptor activity | |
Molecular Function | syntaxin binding | |
Biological Process | exocytosis | |
Biological Process | intracellular protein transmembrane transport | |
Biological Process | ovulation | |
Biological Process | secretion | |
Biological Process | synaptic vesicle fusion to presynaptic active zone membrane | |
Biological Process | synaptic vesicle priming |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSoluble NSF attachment protein 29
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionP83351
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown results in the aberrant secretion and processing of the aspartic protease hrg-7 with accumulation of hrg-7 in its immature uncleaved form and in the intestine.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000213615 | 1-277 | Soluble NSF attachment protein 29 | |||
Sequence: MSRNPFDDDYRPSAASSTMPVKSYTTMGHYSGEDEADYYEREIEKTLQESLDSTERSRRHLENSEKIGTSTAQQLLEQREKLENTEKNLDEIHRTTQMTQRNLNSLKSFFGGMFKNKFTKKPQEPTETPTVPQSKSASRLSETATNLSSGGGSATFSGPSGQRTLTESSRSAIKGTRWEAMDNQIDENLDMMSANLRNLQRLGADLGKEVDSQNEMLDRIQYKAERNDGIVRDQDKQMQKILGTGASTSQTTAESLTPSMDTSTKMSLMMKATSLWK |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-30 | Disordered | ||||
Sequence: MSRNPFDDDYRPSAASSTMPVKSYTTMGHY | ||||||
Domain | 44-106 | t-SNARE coiled-coil homology 1 | ||||
Sequence: EKTLQESLDSTERSRRHLENSEKIGTSTAQQLLEQREKLENTEKNLDEIHRTTQMTQRNLNSL | ||||||
Compositional bias | 49-65 | Basic and acidic residues | ||||
Sequence: ESLDSTERSRRHLENSE | ||||||
Region | 49-73 | Disordered | ||||
Sequence: ESLDSTERSRRHLENSEKIGTSTAQ | ||||||
Region | 117-170 | Disordered | ||||
Sequence: KFTKKPQEPTETPTVPQSKSASRLSETATNLSSGGGSATFSGPSGQRTLTESSR | ||||||
Compositional bias | 123-170 | Polar residues | ||||
Sequence: QEPTETPTVPQSKSASRLSETATNLSSGGGSATFSGPSGQRTLTESSR | ||||||
Domain | 179-241 | t-SNARE coiled-coil homology 2 | ||||
Sequence: EAMDNQIDENLDMMSANLRNLQRLGADLGKEVDSQNEMLDRIQYKAERNDGIVRDQDKQMQKI |
Sequence similarities
Belongs to the SNAP-25 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length277
- Mass (Da)31,115
- Last updated2002-06-06 v1
- ChecksumEF33EBA0ED2574B5
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 49-65 | Basic and acidic residues | ||||
Sequence: ESLDSTERSRRHLENSE | ||||||
Compositional bias | 123-170 | Polar residues | ||||
Sequence: QEPTETPTVPQSKSASRLSETATNLSSGGGSATFSGPSGQRTLTESSR |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284603 EMBL· GenBank· DDBJ | CCD71830.1 EMBL· GenBank· DDBJ | Genomic DNA |