P83227 · VNPB_OXYMI

Function

function

Snake venom natriuretic peptide that exhibits vasoactive and probable hypotensive activity (PubMed:15652496).
Is only weakly active on natriuretic peptide receptor-C (NPR3) (PubMed:15652496).
Stimulates cGMP production through the natriuretic peptide receptor 1 (NPR1) with moderate potencies for the rat NPR1 (EC50=1200 nM), and very weak potencies over human NPR1 (30% activation at 10 uM) (PubMed:37049825).
In vivo, does not impact systolic and diastolic blood pressure, as well as heart rate, when intravenously injected in conscious rabbits (PubMed:37049825).
Does not affect the bradycardia due to cardiac afferent stimulation (Bezold-Jarisch reflex) (PubMed:37049825).

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentextracellular region
Molecular Functionhormone activity
Molecular Functiontoxin activity
Biological Processregulation of blood pressure
Biological Processvasodilation

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Natriuretic peptide TNPb
  • Short names
    TNP-b
  • Alternative names
    • Taipan natriuretic peptide
    • Venom natriuretic peptide OxsSNPb

Organism names

Accessions

  • Primary accession
    P83227

Subcellular Location

Keywords

PTM/Processing

Features

Showing features for peptide, disulfide bond.

Type
IDPosition(s)Description
PeptidePRO_00000450721-35Natriuretic peptide TNPb
Disulfide bond9↔25

Keywords

Expression

Tissue specificity

Expressed by the venom gland.

Structure

Family & Domains

Sequence similarities

Belongs to the natriuretic peptide family.

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    35
  • Mass (Da)
    3,663
  • Last updated
    2002-03-01 v1
  • MD5 Checksum
    E48413FFBE348A5B6E7B2D0865AB34E5
SDPKIGDGCFGLPLDHIGSVSGLGCNRPVQNRPKK

Mass Spectrometry

Molecular mass is 3,661 Da. Determined by Electrospray.

Keywords

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help