P83211 · HSP1_BOLBR
- ProteinSperm protamine P1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids107 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Protamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis. They compact sperm DNA into a highly condensed, stable and inactive complex.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleosome | |
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Biological Process | cell differentiation | |
Biological Process | chromosome condensation | |
Biological Process | spermatogenesis |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSperm protamine P1
Organism names
- Taxonomic lineageEukaryota > Metazoa > Spiralia > Lophotrochozoa > Mollusca > Gastropoda > Caenogastropoda > Neogastropoda > Muricoidea > Muricidae > Bolinus
Accessions
- Primary accessionP83211
Subcellular Location
PTM/Processing
Features
Showing features for propeptide, chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Propeptide | PRO_0000025827 | 1-35 | Removed in mature form | |||
Sequence: ALRKVDRNRFVLDNVTPQPREAKRYKEEEEFPGHG | ||||||
Chain | PRO_0000025828 | 36-107 | Sperm protamine P1 | |||
Sequence: RRRRRRSKGKGKAKGKGKGKGKRRRRRKGKGKGKGKKKGKGRRRRCRRGRGCKKRKGKKGKGRRRRRGKKGK | ||||||
Modified residue | 42 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
A series of N-terminal cleavages yield the mature protein.
Only the mature protein is phosphorylated.
Keywords
- PTM
PTM databases
Expression
Tissue specificity
Gonads.
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-107 | Disordered | ||||
Sequence: ALRKVDRNRFVLDNVTPQPREAKRYKEEEEFPGHGRRRRRRSKGKGKAKGKGKGKGKRRRRRKGKGKGKGKKKGKGRRRRCRRGRGCKKRKGKKGKGRRRRRGKKGK | ||||||
Compositional bias | 19-35 | Basic and acidic residues | ||||
Sequence: PREAKRYKEEEEFPGHG | ||||||
Compositional bias | 36-107 | Basic residues | ||||
Sequence: RRRRRRSKGKGKAKGKGKGKGKRRRRRKGKGKGKGKKKGKGRRRRCRRGRGCKKRKGKKGKGRRRRRGKKGK |
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length107
- Mass (Da)12,584
- Last updated2002-03-01 v1
- Checksum3B1BCE4240A93F2D
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 19-35 | Basic and acidic residues | ||||
Sequence: PREAKRYKEEEEFPGHG | ||||||
Compositional bias | 36-107 | Basic residues | ||||
Sequence: RRRRRRSKGKGKAKGKGKGKGKRRRRRKGKGKGKGKKKGKGRRRRCRRGRGCKKRKGKKGKGRRRRRGKKGK |
Mass Spectrometry
Keywords
- Technical term