P82809 · AK1CD_MESAU
- ProteinAldo-keto reductase family 1 member C13
- GeneAKR1C13
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids322 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Catalyzes the dehydrogenation of morphine to morphinone. The enzyme also exhibits significant activity for a variety of cyclic and alicyclic alcohols. In addition to xenobiotics, the enzyme catalyzes the dehydrogenation of 17-beta-hydroxysteroids with much higher affinities than morphine. Uses both NAD and NADP, but the activity is much greater with NAD than with NADP.
Catalytic activity
- morphine + NAD+ = H+ + morphinone + NADH
Activity regulation
Strongly inhibited by sulfhydryl reagents and ketamine, but not by pyrazole, barbital and indomethacine.
pH Dependence
Optimum pH is 9.3 with NAD as the cofactor.
Features
Showing features for binding site, active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 20-24 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: GFGTY | ||||||
Binding site | 50 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Active site | 55 | Proton donor | ||||
Sequence: Y | ||||||
Site | 84 | Lowers pKa of active site Tyr | ||||
Sequence: K | ||||||
Binding site | 117 | substrate | ||||
Sequence: H | ||||||
Binding site | 166-167 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: SN | ||||||
Binding site | 190 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 216-224 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: FGALGTQRY | ||||||
Binding site | 270-280 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: QSFYESEMKEN |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | aldose reductase (NADPH) activity | |
Molecular Function | ketosteroid monooxygenase activity | |
Molecular Function | morphine 6-dehydrogenase activity | |
Molecular Function | steroid dehydrogenase activity | |
Biological Process | alkaloid metabolic process | |
Biological Process | steroid metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAldo-keto reductase family 1 member C13
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Cricetidae > Cricetinae > Mesocricetus
Accessions
- Primary accessionP82809
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000124643 | 1-322 | Aldo-keto reductase family 1 member C13 | |||
Sequence: XXXXXXXXXXXDGHCIPALGFGTYKPIEVPKSKAMEAANLAIGVGYRHIDTAYAYQIEEEIGQAIQSNIKAGIVKREDMFITTKLWCTCFQPELVRPSLEKXXXKLQLEHVDLFIMHYPVPMKAGDNDFPLDEQGKLLLDTVDFCATWEALEKXXDAGLVKSIGVSNFNMRQLERILNKPGLKYKPVCNQVECHVYNNQSKLLDYCKSKDIVLVAFGALGTQRYKEWVDQDSPVLLNDPVLCGGAKXXXRSPALIALRYLVQRGVVPLAQSFYESEMKENLQVFEFQLSPEDMKILDGLNKNFRYLPAQFFADHPEYPFSEE |
Post-translational modification
The N-terminus is blocked.
Interaction
Structure
Sequence
- Sequence statusComplete
- Length322
- Mass (Da)36,507
- Last updated2001-03-01 v1
- Checksum0CFC67A8E37D2685
Keywords
- Technical term