P82650 · RT22_HUMAN
- ProteinSmall ribosomal subunit protein mS22
- GeneMRPS22
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids360 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrial ribosome | |
Cellular Component | mitochondrial small ribosomal subunit | |
Cellular Component | mitochondrion | |
Molecular Function | structural constituent of ribosome | |
Biological Process | mitochondrial translation |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSmall ribosomal subunit protein mS22
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP82650
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Combined oxidative phosphorylation deficiency 5 (COXPD5)
- Note
- DescriptionA mitochondrial disease resulting in severe metabolic acidosis, edema, hypertrophic cardiomyopathy, tubulopathy, and hypotonia.
- See alsoMIM:611719
Natural variants in COXPD5
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_042733 | 170 | R>H | in COXPD5; dbSNP:rs119478059 |
Ovarian dysgenesis 7 (ODG7)
- Note
- DescriptionA form of ovarian dysgenesis, a disorder characterized by lack of spontaneous pubertal development, primary amenorrhea, uterine hypoplasia, and hypergonadotropic hypogonadism as a result of streak gonads. ODG7 is an autosomal recessive condition.
- See alsoMIM:618117
Natural variants in ODG7
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_081186 | 135 | R>Q | in ODG7; uncertain significance; dbSNP:rs774237195 | |
VAR_081187 | 202 | R>H | in ODG7; uncertain significance; dbSNP:rs753345594 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_081186 | 135 | in ODG7; uncertain significance; dbSNP:rs774237195 | |||
Sequence: R → Q | ||||||
Natural variant | VAR_042733 | 170 | in COXPD5; dbSNP:rs119478059 | |||
Sequence: R → H | ||||||
Natural variant | VAR_081187 | 202 | in ODG7; uncertain significance; dbSNP:rs753345594 | |||
Sequence: R → H |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 392 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000087703 | 1-360 | Small ribosomal subunit protein mS22 | |||
Sequence: MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS | ||||||
Modified residue | 54 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 211 | N6-acetyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Component of the mitochondrial small ribosomal subunit (mt-SSU). Mature mammalian 55S mitochondrial ribosomes consist of a small (28S) and a large (39S) subunit. The 28S small subunit contains a 12S ribosomal RNA (12S mt-rRNA) and 30 different proteins. The 39S large subunit contains a 16S rRNA (16S mt-rRNA), a copy of mitochondrial valine transfer RNA (mt-tRNA(Val)), which plays an integral structural role, and 52 different proteins.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P82650 | MRPS18B Q9Y676 | 5 | EBI-1050752, EBI-750085 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P82650-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length360
- Mass (Da)41,280
- Last updated2000-10-01 v1
- Checksum2DB50257C222D706
P82650-2
- Name2
Computationally mapped potential isoform sequences
There are 10 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
H7C5H3 | H7C5H3_HUMAN | MRPS22 | 200 | ||
H7C5L9 | H7C5L9_HUMAN | MRPS22 | 329 | ||
H7C5F2 | H7C5F2_HUMAN | MRPS22 | 165 | ||
G5E9W7 | G5E9W7_HUMAN | MRPS22 | 290 | ||
A0A8I5KQ79 | A0A8I5KQ79_HUMAN | MRPS22 | 63 | ||
A0A8I5KQR7 | A0A8I5KQR7_HUMAN | MRPS22 | 133 | ||
A0A8I5KSY5 | A0A8I5KSY5_HUMAN | MRPS22 | 342 | ||
A0A8I5KX02 | A0A8I5KX02_HUMAN | MRPS22 | 233 | ||
A0A8I5KYF1 | A0A8I5KYF1_HUMAN | MRPS22 | 332 | ||
A0A7P0MKV3 | A0A7P0MKV3_HUMAN | MRPS22 | 359 |
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF321613 EMBL· GenBank· DDBJ | AAK01406.1 EMBL· GenBank· DDBJ | mRNA | ||
AF063603 EMBL· GenBank· DDBJ | AAG43162.1 EMBL· GenBank· DDBJ | mRNA | ||
AF226045 EMBL· GenBank· DDBJ | AAF86945.1 EMBL· GenBank· DDBJ | mRNA | ||
AC024933 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC069525 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC119740 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC130416 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC009296 EMBL· GenBank· DDBJ | AAH09296.1 EMBL· GenBank· DDBJ | mRNA |