P82242 · PLAL1_PLALA
- ProteinMajor pollen allergen Pla l 1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids131 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | zinc ion binding |
Keywords
- Ligand
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameMajor pollen allergen Pla l 1
- Allergen namePla l 1
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Lamiales > Plantaginaceae > Plantagineae > Plantago
Accessions
- Primary accessionP82242
- Secondary accessions
Subcellular Location
Phenotypes & Variants
Allergenic properties
Causes an allergic reaction in human. Binds to IgE. The English plantain pollen is an important cause of pollinosis in the temperate regions of North America, Australia and Europe. The glycan moiety does not seem to constitute a relevant allergenic epitope.
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 58 | in Pla l 1.0102 and 1.0103 | ||||
Sequence: D → G | ||||||
Natural variant | 82 | in Pla l 1.0103 | ||||
Sequence: S → G |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 2 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Protein family/group databases
PTM/Processing
Features
Showing features for chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000215117 | 1-131 | Major pollen allergen Pla l 1 | |||
Sequence: TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETDQDGVYRLPVVGYHEDCEIKLVKSSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFRAKTDAPGC | ||||||
Disulfide bond | 17↔86 | |||||
Sequence: CNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETDQDGVYRLPVVGYHEDCEIKLVKSSRPDC | ||||||
Disulfide bond | 20↔131 | |||||
Sequence: CHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETDQDGVYRLPVVGYHEDCEIKLVKSSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFRAKTDAPGC | ||||||
Disulfide bond | 42↔74 | |||||
Sequence: CKDDSKKVIYSIGGETDQDGVYRLPVVGYHEDC | ||||||
Glycosylation | 107 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
Exists in two variants: glycosylated and non-glycosylated. Carries a complex, major N-linked glycan, with a alpha-1,3-fucose residue in its structure and probably also a beta-1,2-xylose. The average modification of molecular mass due to glycosylation is approximately 969 Da.
Keywords
- PTM
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length131
- Mass (Da)14,521
- Last updated2003-02-12 v2
- Checksum62F9B279ED3A4BC6
Keywords
- Technical term