P80109 · PHLD_BOVIN
- ProteinPhosphatidylinositol-glycan-specific phospholipase D
- GeneGPLD1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids839 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
This protein hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans (GPI-anchor) thus releasing these proteins from the membrane.
Catalytic activity
- an alpha-D-GlcN-(1->6)-(1,2-diacyl-sn-glycero-3-phospho)-1D-myo-inositol + H2O = 6-(alpha-D-glucosaminyl)-1D-myo-inositol + a 1,2-diacyl-sn-glycero-3-phosphate + H+
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePhosphatidylinositol-glycan-specific phospholipase D
- EC number
- Short namesPI-G PLD
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Bovinae > Bos
Accessions
- Primary accessionP80109
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Associated with the High-Density Lipoproteins (HDL).
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 834 | Severe loss of enzymatic activity. | ||||
Sequence: Y → A |
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MSAFRFWSGLLMLLGFLCPRSSP | ||||||
Chain | PRO_0000022053 | 24-839 | Phosphatidylinositol-glycan-specific phospholipase D | |||
Sequence: CGISTHIEIGHRALEFLHLQDGSINYKELLLRHQDAYQAGSVFPDSFYPSICERGQFHDVSESTHWTPFLNASVHYIRKNYPLPWDEDTEKLVAFLFGITSHMVADVNWHSLGIEQGFLRTMAAIDFHNSYPEAHPAGDFGGDVLSQFEFKFNYLSRHWYVPAEDLLGIYRELYGRIVITKKAIVDCSYLQFLEMYAEMLAISKLYPTYSVKSPFLVEQFQEYFLGGLEDMAFWSTNIYHLTSYMLKNGTSNCNLPENPLFITCGGQQNNTHGSKVQKNGFHKNVTAALTKNIGKHINYTKRGVFFSVDSWTMDSLSFMYKSLERSIREMFIGSSQPLTHVSSPAASYYLSFPYTRLGWAMTSADLNQDGYGDLVVGAPGYSHPGRIHVGRVYLIYGNDLGLPRIDLDLDKEAHGILEGFQPSGRFGSAVAVLDFNVDGVPDLAVGAPSVGSEKLTYTGAVYVYFGSKQGQLSSSPNVTISCQDTYCNLGWTLLAADVNGDSEPDLVIGSPFAPGGGKQKGIVAAFYSGSSYSSREKLNVEAANWMVKGEEDFAWLGYSLHGVNVNNRTLLLAGSPTWKDTSSQGHLFRTRDEKQSPGRVYGYFPPICQSWFTISGDKAMGKLGTSLSSGHVMVNGTRTQVLLVGAPTQDVVSKVSFLTMTLHQGGSTRMYELTPDSQPSLLSTFSGNRRFSRFGGVLHLSDLDNDGLDEIIVAAPLRITDATAGLMGEEDGRVYVFNGKQITVGDVTGKCKSWVTPCPEEKAQYVLISPEAGSRFGSSVITVRSKEKNQVIIAAGRSSLGARLSGVLHIYRLGQD | ||||||
Glycosylation | 94 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 271 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 292 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 307 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 321 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 500 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 590 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 658 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
Glycosylated.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 365-427 | FG-GAP 1 | ||||
Sequence: SSPAASYYLSFPYTRLGWAMTSADLNQDGYGDLVVGAPGYSHPGRIHVGRVYLIYGNDLGLPR | ||||||
Repeat | 434-496 | FG-GAP 2 | ||||
Sequence: KEAHGILEGFQPSGRFGSAVAVLDFNVDGVPDLAVGAPSVGSEKLTYTGAVYVYFGSKQGQLS | ||||||
Repeat | 498-558 | FG-GAP 3 | ||||
Sequence: SPNVTISCQDTYCNLGWTLLAADVNGDSEPDLVIGSPFAPGGGKQKGIVAAFYSGSSYSSR | ||||||
Repeat | 562-622 | FG-GAP 4 | ||||
Sequence: NVEAANWMVKGEEDFAWLGYSLHGVNVNNRTLLLAGSPTWKDTSSQGHLFRTRDEKQSPGR | ||||||
Repeat | 632-692 | FG-GAP 5 | ||||
Sequence: QSWFTISGDKAMGKLGTSLSSGHVMVNGTRTQVLLVGAPTQDVVSKVSFLTMTLHQGGSTR | ||||||
Repeat | 703-769 | FG-GAP 6 | ||||
Sequence: SLLSTFSGNRRFSRFGGVLHLSDLDNDGLDEIIVAAPLRITDATAGLMGEEDGRVYVFNGKQITVGD | ||||||
Repeat | 787-839 | FG-GAP 7 | ||||
Sequence: QYVLISPEAGSRFGSSVITVRSKEKNQVIIAAGRSSLGARLSGVLHIYRLGQD |
Sequence similarities
Belongs to the GPLD1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length839
- Mass (Da)92,602
- Last updated1993-07-01 v1
- ChecksumF9BFF8A00226BF40
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 181 | in Ref. 2; AA sequence | ||||
Sequence: H → F | ||||||
Sequence conflict | 184 | in Ref. 2; AA sequence | ||||
Sequence: V → L | ||||||
Sequence conflict | 235 | in Ref. 2; AA sequence | ||||
Sequence: K → R | ||||||
Sequence conflict | 634 | in Ref. 2; AA sequence | ||||
Sequence: W → P | ||||||
Sequence conflict | 777 | in Ref. 2; AA sequence | ||||
Sequence: W → N | ||||||
Sequence conflict | 780 | in Ref. 2; AA sequence | ||||
Sequence: P → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M60804 EMBL· GenBank· DDBJ | AAA30721.1 EMBL· GenBank· DDBJ | mRNA |