P79728 · EFNA5_DANRE
- ProteinEphrin-A5b
- Geneefna5b
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids228 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the epha3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor epha2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation (By similarity).
Controls axon growth and may be involved in the creation of the retino-tectal map
Controls axon growth and may be involved in the creation of the retino-tectal map
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | external side of plasma membrane | |
Cellular Component | plasma membrane | |
Molecular Function | ephrin receptor binding | |
Biological Process | axon guidance | |
Biological Process | ephrin receptor signaling pathway | |
Biological Process | mesoderm migration involved in gastrulation | |
Biological Process | positive regulation of peptidyl-tyrosine phosphorylation | |
Biological Process | regulation of actin cytoskeleton organization | |
Biological Process | regulation of cell-cell adhesion | |
Biological Process | regulation of focal adhesion assembly | |
Biological Process | regulation of GTPase activity | |
Biological Process | regulation of microtubule cytoskeleton organization | |
Biological Process | somitogenesis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameEphrin-A5b
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionP79728
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MLQAEMIVFVGVILWMCVFS | ||||||
Chain | PRO_0000008385 | 21-204 | Ephrin-A5b | |||
Sequence: QEPSSKVMADRYAVFWNRTNPRFQRGDYHIDVCINDYLDVYCPHYEDSVPEERTERYVLYMVNYDGYSTCDHTAKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYYYISSMITETGRRSCLKLKVFVRPPNGCEKTIGVHDRVFVDDKVDNALEPRDDTSHEAEPSRSDVSTS | ||||||
Glycosylation | 37 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 62↔102 | |||||
Sequence: CPHYEDSVPEERTERYVLYMVNYDGYSTCDHTAKGFKRWEC | ||||||
Disulfide bond | 90↔151 | |||||
Sequence: CDHTAKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYYYISSMITETGRRSC | ||||||
Lipidation | 204 | GPI-anchor amidated serine | ||||
Sequence: S | ||||||
Propeptide | PRO_0000008386 | 205-228 | Removed in mature form | |||
Sequence: GLRHQTSRPLLALLLLCISLYLLL |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Widespread expression in the embryo.
Developmental stage
Expressed in the presumptive midbrain of developing embryos from the six-somite stage. By 24 hours, strongly expressed in the midbrain caudal to the presumptive tectum. At later stages, maintained at the posterior margin of the tectum.
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P79728 | epha3 O13146 | 2 | EBI-42473236, EBI-42473062 | |
BINARY | P79728 | epha4a Q5ZEW1 | 2 | EBI-42473236, EBI-42473157 | |
BINARY | P79728 | epha7 A0A8M9PHF0 | 2 | EBI-42473236, EBI-42473126 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 29-162 | Ephrin RBD | ||||
Sequence: ADRYAVFWNRTNPRFQRGDYHIDVCINDYLDVYCPHYEDSVPEERTERYVLYMVNYDGYSTCDHTAKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYYYISSMITETGRRSCLKLKVFVRPPN | ||||||
Region | 184-205 | Disordered | ||||
Sequence: LEPRDDTSHEAEPSRSDVSTSG |
Sequence similarities
Belongs to the ephrin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length228
- Mass (Da)26,595
- Last updated1997-05-01 v1
- Checksum74B3406C05418E6E
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Y09669 EMBL· GenBank· DDBJ | CAA70864.1 EMBL· GenBank· DDBJ | mRNA |