P79175 · C5AR1_GORGO
- ProteinC5a anaphylatoxin chemotactic receptor 1
- GeneC5AR1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids350 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region which activates downstream signaling events. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apical part of cell | |
Cellular Component | basolateral plasma membrane | |
Cellular Component | cytoplasmic vesicle | |
Cellular Component | plasma membrane | |
Molecular Function | complement component C5a receptor activity | |
Molecular Function | G protein-coupled receptor activity | |
Biological Process | chemotaxis | |
Biological Process | complement receptor mediated signaling pathway | |
Biological Process | inflammatory response | |
Biological Process | mRNA transcription by RNA polymerase II | |
Biological Process | phospholipase C-activating G protein-coupled receptor signaling pathway | |
Biological Process | positive regulation of cytosolic calcium ion concentration | |
Biological Process | positive regulation of epithelial cell proliferation | |
Biological Process | positive regulation of ERK1 and ERK2 cascade |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameC5a anaphylatoxin chemotactic receptor 1
- Alternative names
- CD Antigen Name
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Gorilla
Accessions
- Primary accessionP79175
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Note: Phosphorylated C5aR colocalizes with ARRB1 and ARRB2 in cytoplasmic vesicles.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-37 | Extracellular | ||||
Sequence: MDSFNYTTPDYGHYDDKDTLDPNTPVDKTSNTLRVPD | ||||||
Transmembrane | 38-64 | Helical; Name=1 | ||||
Sequence: ILALVIFAVVFLVGVLGNALVVWVTAF | ||||||
Topological domain | 65-69 | Cytoplasmic | ||||
Sequence: EVKRT | ||||||
Transmembrane | 70-93 | Helical; Name=2 | ||||
Sequence: INAIWFLNLAVADFLSCLALPILF | ||||||
Topological domain | 94-110 | Extracellular | ||||
Sequence: TSIVQHHHWPFGGAACR | ||||||
Transmembrane | 111-132 | Helical; Name=3 | ||||
Sequence: ILPSLILLNMYASILLLATISA | ||||||
Topological domain | 133-153 | Cytoplasmic | ||||
Sequence: DRFLLVFKPIWCQNFRGAGLA | ||||||
Transmembrane | 154-174 | Helical; Name=4 | ||||
Sequence: WIACAVAWGLALLLTIPSFLY | ||||||
Topological domain | 175-200 | Extracellular | ||||
Sequence: RVVREEYFPPKVLCGVDYSHDKQRER | ||||||
Transmembrane | 201-226 | Helical; Name=5 | ||||
Sequence: AVAVVRLVLGFLWPLLTLTICYTFIL | ||||||
Topological domain | 227-242 | Cytoplasmic | ||||
Sequence: LRTWSRRATRSTKTLK | ||||||
Transmembrane | 243-265 | Helical; Name=6 | ||||
Sequence: VVVAVVASFFIFWLPYQVTGIMM | ||||||
Topological domain | 266-282 | Extracellular | ||||
Sequence: SFLEPSSPTFLLLKKLD | ||||||
Transmembrane | 283-303 | Helical; Name=7 | ||||
Sequence: SLCVSFAYINCCINPIIYVVA | ||||||
Topological domain | 304-350 | Cytoplasmic | ||||
Sequence: GQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAEKTQAV |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000069208 | 1-350 | C5a anaphylatoxin chemotactic receptor 1 | |||
Sequence: MDSFNYTTPDYGHYDDKDTLDPNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEVKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACRILPSLILLNMYASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKQRERAVAVVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAEKTQAV | ||||||
Modified residue | 11 | Sulfotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 14 | Sulfotyrosine | ||||
Sequence: Y | ||||||
Disulfide bond | 109↔188 | |||||
Sequence: CRILPSLILLNMYASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLC | ||||||
Modified residue | 314 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 317 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 327 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 332 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 334 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 338 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Sulfation plays a critical role in the association of C5aR with C5a, but no significant role in the ability of the receptor to transduce a signal and mobilize calcium in response to a small peptide agonist. Sulfation at Tyr-14 is important for CHIPS binding.
Phosphorylated on serine residues in response to C5a binding, resulting in internalization of the receptor and short-term desensitization to C5a.
Keywords
- PTM
Expression
Gene expression databases
Interaction
Subunit
Homodimer. May also form higher-order oligomers. Interacts (when phosphorylated) with ARRB1 and ARRB2; the interaction is associated with internalization of C5aR. Interacts (via N-terminal domain) with S.aureus chemotaxis inhibitory protein (CHIPS); the interaction blocks the receptor and may thus inhibit the immune response.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 10-18 | Required for CHIPS binding | ||||
Sequence: DYGHYDDKD | ||||||
Region | 21-30 | Involved in C5a binding | ||||
Sequence: DPNTPVDKTS |
Sequence similarities
Belongs to the G-protein coupled receptor 1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Protein family/group databases
Sequence
- Sequence statusComplete
- Length350
- Mass (Da)39,376
- Last updated2015-01-07 v2
- Checksum5229D43B0D900CFC
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A2I2YTC2 | A0A2I2YTC2_GORGO | 351 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 57 | in Ref. 2; CAA66317 | ||||
Sequence: L → M | ||||||
Sequence conflict | 66 | in Ref. 2; CAA66317 | ||||
Sequence: V → A | ||||||
Sequence conflict | 197 | in Ref. 2; CAA66317 | ||||
Sequence: Q → R | ||||||
Sequence conflict | 204 | in Ref. 2; CAA66317 | ||||
Sequence: V → I | ||||||
Sequence conflict | 279 | in Ref. 2; CAA66317 | ||||
Sequence: K → N | ||||||
Sequence conflict | 345 | in Ref. 2; CAA66317 | ||||
Sequence: E → Q |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X97733 EMBL· GenBank· DDBJ | CAA66317.1 EMBL· GenBank· DDBJ | Genomic DNA |