P78369 · CLD10_HUMAN
- ProteinClaudin-10
- GeneCLDN10
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids228 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Forms paracellular channels: polymerizes in tight junction strands with cation- and anion-selective channels through the strands, conveying epithelial permeability in a process known as paracellular tight junction permeability.
Isoform 1
Forms cation-selective paracellular channels. In sweat glands and in the thick ascending limb (TAL) of Henle's loop in kidney, it controls paracellular sodium permeability which is essential for proper sweat production and renal function (PubMed:19383724, PubMed:28771254, PubMed:28686597, PubMed:35650657, PubMed:36008380).
Isoform 2
Forms anion-selective paracellular channels. In renal proximal tubules, it conveys selective chloride over hydrogencarbonate anion permeability which is required for renal chloride reabsorption and salt homeostasis.
Catalytic activity
Isoform 1
Na+(in) = Na+(out)Isoform 1
Li+(in) = Li+(out)Isoform 1
K+(in) = K+(out)Isoform 1
Rb+(in) = Rb+(out)Isoform 1
Cs+(in) = Cs+(out)- NH4+(in) = NH4+(out)
- methylamine(out) = methylamine(in)
Isoform 1
Mg2+(in) = Mg2+(out)Isoform 1
Ca2+(in) = Ca2+(out)Isoform 1
Sr2+(in) = Sr2+(out)Isoform 2
chloride(in) = chloride(out)Isoform 2
nitrate(in) = nitrate(out)
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | bicellular tight junction | |
Cellular Component | cytoplasm | |
Cellular Component | plasma membrane | |
Cellular Component | tight junction | |
Molecular Function | identical protein binding | |
Molecular Function | paracellular tight junction channel activity | |
Molecular Function | structural molecule activity | |
Biological Process | bicellular tight junction assembly | |
Biological Process | calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules | |
Biological Process | cell adhesion | |
Biological Process | monoatomic ion transport | |
Biological Process | paracellular transport | |
Biological Process | regulation of monoatomic ion transport |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameClaudin-10
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP78369
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Isoform 1
Cell membrane ; Multi-pass membrane protein
Isoform 2
Cell membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane, topological domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 1-21 | Helical | ||||
Sequence: MASTASEIIAFMVSISGWVLV | ||||||
Topological domain | 22-80 | Extracellular | ||||
Sequence: SSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACR | ||||||
Transmembrane | 81-101 | Helical | ||||
Sequence: GLMIAAVSLGFFGSIFALFGM | ||||||
Topological domain | 102-115 | Cytoplasmic | ||||
Sequence: KCTKVGGSDKAKAK | ||||||
Transmembrane | 116-136 | Helical | ||||
Sequence: IACLAGIVFILSGLCSMTGCS | ||||||
Topological domain | 137-160 | Extracellular | ||||
Sequence: LYANKITTEFFDPLFVEQKYELGA | ||||||
Transmembrane | 161-181 | Helical | ||||
Sequence: ALFIGWAGASLCIIGGVIFCF | ||||||
Topological domain | 182-228 | Cytoplasmic | ||||
Sequence: SISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
HELIX syndrome (HELIX)
- Note
- DescriptionAn autosomal recessive disease characterized by congenital heat intolerance, generalized anhidrosis, inability to produce tears, dry mouth, electrolyte imbalance, and ichthyosis.
- See alsoMIM:617671
Natural variants in HELIX
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_080053 | 48 | N>K | in HELIX; decreased function in regulation of paracellular ion transport as shown by reduced sodium permeability of cell layers expressing the mutant; affects self-interaction by inhibiting homodimerization in trans and promoting homodimerization in cis; no effect on localization to plasma membrane; dbSNP:rs759408749 | |
VAR_080054 | 131 | S>L | in HELIX; strongly reduced localization at the plasma membrane; dbSNP:rs1555299783 |
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 36 | No effect on tight junction strand formation and ion selectivity. | ||||
Sequence: D → A | ||||||
Natural variant | VAR_080053 | 48 | in HELIX; decreased function in regulation of paracellular ion transport as shown by reduced sodium permeability of cell layers expressing the mutant; affects self-interaction by inhibiting homodimerization in trans and promoting homodimerization in cis; no effect on localization to plasma membrane; dbSNP:rs759408749 | |||
Sequence: N → K | ||||||
Mutagenesis | 64 | Hinders formation of tight junction strands. A small fraction of these mutants is integrated into tight junction network resulting in increased permeability for monovalent cations. | ||||
Sequence: K → W or M | ||||||
Natural variant | VAR_080054 | 131 | in HELIX; strongly reduced localization at the plasma membrane; dbSNP:rs1555299783 | |||
Sequence: S → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 251 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000144757 | 1-228 | UniProt | Claudin-10 | |||
Sequence: MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV | |||||||
Modified residue (large scale data) | 199 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 202 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the kidney, eccrine sweat glands and in all layers of the epidermis. In the kidney, it is detected in the thick ascending limb of Henle's loop (TAL) (PubMed:28771254, PubMed:28686597).
In the sweat glands, it is expressed in cells from secretory portions, corresponding to the clear cells (PubMed:28686597).
In the sweat glands, it is expressed in cells from secretory portions, corresponding to the clear cells (PubMed:28686597).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Can form homodimers both in trans (interaction between CLDN10 molecules in opposing membranes) and in cis (interaction between CLDN10 molecules within one membrane).
Isoform 1
Interacts with CLDN19.
Isoform 2
Interacts with CLDN19.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P78369 | BEST2 Q8NFU1 | 3 | EBI-13372810, EBI-19947314 | |
BINARY | P78369 | CISD2 Q8N5K1 | 3 | EBI-13372810, EBI-1045797 | |
BINARY | P78369 | HSD17B13 Q7Z5P4 | 3 | EBI-13372810, EBI-18053395 | |
BINARY | P78369 | OPRM1 P35372-10 | 3 | EBI-13372810, EBI-12807478 | |
BINARY | P78369 | PEX12 O00623 | 3 | EBI-13372810, EBI-594836 | |
BINARY | P78369 | REEP1 Q9H902 | 3 | EBI-13372810, EBI-1644241 | |
BINARY | P78369 | TMEM14B Q9NUH8 | 3 | EBI-13372810, EBI-8638294 | |
BINARY | P78369 | TMEM9 Q9P0T7 | 3 | EBI-13372810, EBI-723976 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Domain
The fourth transmembrane region (161-181) is necessary for integration into tight junctions.
Sequence similarities
Belongs to the claudin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
P78369-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsCldn10b
- Length228
- Mass (Da)24,488
- Last updated1998-08-01 v2
- Checksum11E66F9F10BCC87B
P78369-2
- Name2
- SynonymsCldn10a
- Differences from canonical
- 1-73: MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALD → MSRAQIWALVSGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGNALGSFHCRPHFTIFKVA
P78369-3
- Name3
- SynonymsCldn10a_i1
- NoteProduced by alternative splicing of isoform 2.
- Differences from canonical
- 1-73: MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALD → MSRAQIWALVSGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCA
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q5W075 | Q5W075_HUMAN | CLDN10 | 73 |
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_042898 | 1-73 | in isoform 2 | |||
Sequence: MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALD → MSRAQIWALVSGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCAGNALGSFHCRPHFTIFKVA | ||||||
Alternative sequence | VSP_053550 | 1-73 | in isoform 3 | |||
Sequence: MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALD → MSRAQIWALVSGVGGFGALVAATTSNEWKVTTRASSVITATWVYQGLWMNCA |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U89916 EMBL· GenBank· DDBJ | AAC79506.1 EMBL· GenBank· DDBJ | mRNA | ||
AK055855 EMBL· GenBank· DDBJ | BAB71030.1 EMBL· GenBank· DDBJ | mRNA | ||
AK315737 EMBL· GenBank· DDBJ | BAG38092.1 EMBL· GenBank· DDBJ | mRNA | ||
CR456845 EMBL· GenBank· DDBJ | CAG33126.1 EMBL· GenBank· DDBJ | mRNA | ||
AL139376 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL357061 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL627382 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471085 EMBL· GenBank· DDBJ | EAX08955.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC010920 EMBL· GenBank· DDBJ | AAH10920.1 EMBL· GenBank· DDBJ | mRNA |