P74103 · FRP_SYNY3
- ProteinFluorescence recovery protein
- Genefrp
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids109 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Destabilizes orange carotenoid protein-R form (OCP-R), the FRP-OCP interaction accelerates the OCP-R to OCP-O conversion (PubMed:20534537, PubMed:23716688).
Increases fluorescence recovery following non-photochemical quenching (NPQ) by OCP, most probably by destabilizing OCP-R binding to the phycobilisome core (PubMed:21764991).
Increases fluorescence recovery following non-photochemical quenching (NPQ) by OCP, most probably by destabilizing OCP-R binding to the phycobilisome core (PubMed:21764991).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane-derived thylakoid membrane |
Names & Taxonomy
Protein names
- Recommended nameFluorescence recovery protein
- Short namesFRP
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Cyanobacteriota > Cyanophyceae > Synechococcales > Merismopediaceae > Synechocystis
Accessions
- Primary accessionP74103
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cellular thylakoid membrane ; Peripheral membrane protein
Note: Very tightly associated with the membrane.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Decreased fluorescence recovery after non-photochemical quenching (NPQ).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 9 | Wild-type role in conversion of OCP-R to OCP-O. | ||||
Sequence: W → L | ||||||
Mutagenesis | 50 | About 75% conversion of OCP-R to OCP-O. | ||||
Sequence: W → F | ||||||
Mutagenesis | 50 | About 25% conversion of OCP-R to OCP-O. | ||||
Sequence: W → L | ||||||
Mutagenesis | 53 | About 50% conversion of OCP-R to OCP-O. | ||||
Sequence: H → L | ||||||
Mutagenesis | 54 | About 75% conversion of OCP-R to OCP-O. | ||||
Sequence: D → E | ||||||
Mutagenesis | 54 | About 25% conversion of OCP-R to OCP-O. | ||||
Sequence: D → L | ||||||
Mutagenesis | 60 | Almost no conversion of OCP-R to OCP-O. | ||||
Sequence: R → K or L |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000434475 | 1-109 | Fluorescence recovery protein | |||
Sequence: MLQTAEAPWSQAETQSAHALFRKAYQRELDGLLATVQAQASQITQIDDLWKLHDFLSAKRHEIDGKYDDRQSVIIFVFAQLLKEGLVQAEELTFLAADKQSKIKALARL |
Proteomic databases
Expression
Induction
Transcribed from its own promoter, it may also be cotranscribed with upstream ocp.
Interaction
Subunit
Probably a dimer, interacts with the C-terminal domain of OCP-R (PubMed:23716688).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P74103 | slr1963 P74102 | 2 | EBI-1618115, EBI-1618104 |
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length109
- Mass (Da)12,370
- Last updated2015-10-14 v2
- Checksum92B9948CECC838C8
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BA000022 EMBL· GenBank· DDBJ | BAA18189.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation |