P73429 · HLIB_SYNY3
- ProteinHigh light-inducible protein HliB
- GenehliB
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in photosystem II (PSII) assembly and/or repair under high light stress; probably important for quick stress responses (Probable) (PubMed:35218444, PubMed:35279779).
HliB-HliC heterodimers associate with PSII assembly intermediates with CP47 (psbB) and bind chlorophyll and carotenoids in a 1:0.6 ratio. They probably protect against photo-oxidation during assembly. Complex binds mostly beta-carotenoid, but minor amounts of echinenone and beta-crytoxanthin are also detected. The complex efficiently quenches chlorophyll fluorescence, contributing to photoprotection (PubMed:35218444).
Deletion of 4 to 5 members of the Hlip family suggests the proteins are involved in regulation of chlorophyll biosynthesis, in stabilization of chlorophyll-binding proteins and/or in reuse of chlorophylls, and may regulate tetrapyrrole biosynthesis (Probable) (PubMed:15107425).
Might bind chlorophyll and/or carotenoids in association with HliA (called the ScpCD pair) (Probable) (PubMed:18836846).
HliB-HliC heterodimers associate with PSII assembly intermediates with CP47 (psbB) and bind chlorophyll and carotenoids in a 1:0.6 ratio. They probably protect against photo-oxidation during assembly. Complex binds mostly beta-carotenoid, but minor amounts of echinenone and beta-crytoxanthin are also detected. The complex efficiently quenches chlorophyll fluorescence, contributing to photoprotection (PubMed:35218444).
Deletion of 4 to 5 members of the Hlip family suggests the proteins are involved in regulation of chlorophyll biosynthesis, in stabilization of chlorophyll-binding proteins and/or in reuse of chlorophylls, and may regulate tetrapyrrole biosynthesis (Probable) (PubMed:15107425).
Might bind chlorophyll and/or carotenoids in association with HliA (called the ScpCD pair) (Probable) (PubMed:18836846).
The Hlips might regulate tetrapyrrole biosynthesis, maybe at the level of aminolevulinic acid synthesis and probably stabilize PSII assembly intermediates (PubMed:22090028).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | photosystem II | |
Cellular Component | plasma membrane-derived thylakoid membrane | |
Cellular Component | thylakoid membrane | |
Molecular Function | chlorophyll binding | |
Molecular Function | pigment binding | |
Biological Process | energy quenching | |
Biological Process | photosystem II assembly |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameHigh light-inducible protein HliB
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Cyanobacteriota > Cyanophyceae > Synechococcales > Merismopediaceae > Synechocystis
Accessions
- Primary accessionP73429
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cellular thylakoid membrane ; Single-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-30 | Cytoplasmic | ||||
Sequence: MTSRGFRLDQDNRLNNFAIEPPVYVDSSVQ | ||||||
Transmembrane | 31-58 | Helical | ||||
Sequence: AGWTEYAEKMNGRFAMIGFVSLLAMEVI | ||||||
Topological domain | 59-70 | Lumenal, thylakoid | ||||
Sequence: TGHGIVGWLLSL |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
No visible growth effect of the single mutant; double hliA-hliB deletions are out-competed by wild-type in high light (500 umol photons/m2/s). Quadruple hliA-hliB-hliC-hliD deletions die rapidly in high light but grow normally in normal light (40 umol photons/m2/s). Quadruple mutants are sensitive to norflurazon (PubMed:11024039).
In a quintuple hliA-hliB-hliC-hliD-hemH deletion chlorophyll half-life decreases 2-fold while the half-life of PSII proteins does not change; photosystem II assembly intermediate RC471 is missing (RC471 is PSII monomer without CP43). De novo chlorophyll synthesis is very slow (PubMed:22090028).
In a quintuple hliA-hliB-hliC-hliD-hemH deletion chlorophyll half-life decreases 2-fold while the half-life of PSII proteins does not change; photosystem II assembly intermediate RC471 is missing (RC471 is PSII monomer without CP43). De novo chlorophyll synthesis is very slow (PubMed:22090028).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000459048 | 1-70 | High light-inducible protein HliB | |||
Sequence: MTSRGFRLDQDNRLNNFAIEPPVYVDSSVQAGWTEYAEKMNGRFAMIGFVSLLAMEVITGHGIVGWLLSL |
Proteomic databases
Expression
Induction
Transcription strongly induced in the absence of photosystem I (PSI). Increased translation in the absence of PSI (at protein level) (PubMed:10413515).
Expressed at very low levels during growth under normal light (40 umol photons/m2/s), induced under high light (500 umol photons/m2/s for 6 hours) with maximal expression by 1 hour and decreasing after, after growth at 4 degrees Celsius for 6 hours and less induced after nitrogen or sulfur deprivation (at protein level). Upon return to normal light protein levels drop rapidly (PubMed:11024039).
Maximally induced by 2 hours of growth at high light (500 umol photons/m2/s), nearly undetectable by 8 hours (at protein level) (PubMed:35279779).
Expressed at very low levels during growth under normal light (40 umol photons/m2/s), induced under high light (500 umol photons/m2/s for 6 hours) with maximal expression by 1 hour and decreasing after, after growth at 4 degrees Celsius for 6 hours and less induced after nitrogen or sulfur deprivation (at protein level). Upon return to normal light protein levels drop rapidly (PubMed:11024039).
Maximally induced by 2 hours of growth at high light (500 umol photons/m2/s), nearly undetectable by 8 hours (at protein level) (PubMed:35279779).
Interaction
Subunit
Forms heterodimers with HliC, these are associated with photosystem II (PSII) assembly intermediates containing CP47 (psbB) but not CP43 (psbC) (PubMed:16923804, PubMed:35218444, PubMed:35279779).
Other studies detect it in PSII complexes with CP43 (PubMed:16923804, PubMed:17105726).
Associates with PSII assembly intermediates close to CP47 and PsbH probably on the periphery of PSII; requires PsbH to bind to PSII (PubMed:16923804).
Cofractionates in an approximately 100 kDa fraction the thylakoid membrane with HliA (PubMed:11024039).
Purified His-tagged protein is associated in vivo with monomeric photosystem II, including components D1, D2, CP43, CP47, PsbH, PsbZ, Psb27, HliA and HliC (ScpC and SpcB respectively); most closely associated with CP47. The same complex includes 3 FtsH homologs. Even in the absence of PSII, does not associated with photosystem I (PSI) (PubMed:17105726).
HliA/HliB and Psb34 probably bind to a similar site on CP47; their binding seems to be mutually exclusive (Probable) (PubMed:35279779).
Other studies detect it in PSII complexes with CP43 (PubMed:16923804, PubMed:17105726).
Associates with PSII assembly intermediates close to CP47 and PsbH probably on the periphery of PSII; requires PsbH to bind to PSII (PubMed:16923804).
Cofractionates in an approximately 100 kDa fraction the thylakoid membrane with HliA (PubMed:11024039).
Purified His-tagged protein is associated in vivo with monomeric photosystem II, including components D1, D2, CP43, CP47, PsbH, PsbZ, Psb27, HliA and HliC (ScpC and SpcB respectively); most closely associated with CP47. The same complex includes 3 FtsH homologs. Even in the absence of PSII, does not associated with photosystem I (PSI) (PubMed:17105726).
HliA/HliB and Psb34 probably bind to a similar site on CP47; their binding seems to be mutually exclusive (Probable) (PubMed:35279779).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 38-43 | Chlorophyll-binding motif | ||||
Sequence: EKMNGR |
Sequence similarities
Belongs to the Hlip family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length70
- Mass (Da)7,822
- Last updated1997-02-01 v1
- Checksum6CBCC64E675169A4
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BA000022 EMBL· GenBank· DDBJ | BAA17469.1 EMBL· GenBank· DDBJ | Genomic DNA |