P70213 · FV1_MOUSE
- ProteinFriend virus susceptibility protein 1
- GeneFv1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids459 (go to sequence)
- Protein existencePredicted
- Annotation score3/5
Function
function
Retroviral restriction factor that prevents infection by gammaretroviruses. Acts by interacting with the capsid protein ca after entry of the virus into the cell. This interaction presumably disrupt the capsid thereby inactivating the viral genome, making it unable to enter host nucleus and integrate into host genome.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Golgi apparatus | |
Biological Process | defense response to virus | |
Biological Process | response to virus |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameFriend virus susceptibility protein 1
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP70213
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 358 | in strain: AKR/J, C3H and DBA/2 | ||||
Sequence: E → K | ||||||
Natural variant | 399 | in strain: AKR/J, C3H and DBA/2; requires 2 nucleotide substitutions | ||||
Sequence: R → V | ||||||
Natural variant | 438-459 | in strain: AKR/J, C3H and DBA/2 | ||||
Sequence: GLTSVGSVGVLSLSPWKHQSNS → TKL |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 55 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000087389 | 1-459 | Friend virus susceptibility protein 1 | |||
Sequence: MNFPRALAGFSSWLFKPELAEDSPDNDSPDNDTVNPWRELLQKINVADLPDSSFSSGKELNDSVYHTFEHFCKIRDYDAVGELLLAFLDKVTKERDQFRDEISQLRMHINDLKASKCVLGETLLSYRHRIEVGEKQTEALIVRLADVQSQVMCQPARKVSADKVRALIGKEWDPVTWDGDVWEDIDSEGSEEAELPTVLASPSLSEESGYALSKERTQQDKADAPQIQSSTSLVTSEPVTRPKSLSDLTSQKHRHTNHELNSLAHSNRQKAKEHARKWILRVWDNGGRLTILDQIEFLSLGPLSLDSEFNVIARTVEDNGVKSLFDWLAEAWVQRWPTTRELQSPDTLEWYSIEDGIERLRELGMIEWLCVKATCPQWRGPEDVPITRAMRITFVRETRETWKSFVFSLLCIKDITVGSVAAQLHDLIELSLKPTAAGLTSVGSVGVLSLSPWKHQSNS |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 192-269 | Disordered | ||||
Sequence: EAELPTVLASPSLSEESGYALSKERTQQDKADAPQIQSSTSLVTSEPVTRPKSLSDLTSQKHRHTNHELNSLAHSNRQ | ||||||
Compositional bias | 222-246 | Polar residues | ||||
Sequence: ADAPQIQSSTSLVTSEPVTRPKSLS | ||||||
Compositional bias | 247-269 | Basic and acidic residues | ||||
Sequence: DLTSQKHRHTNHELNSLAHSNRQ |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length459
- Mass (Da)51,997
- Last updated1997-02-01 v1
- ChecksumB112FD4645EFA489
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 222-246 | Polar residues | ||||
Sequence: ADAPQIQSSTSLVTSEPVTRPKSLS | ||||||
Compositional bias | 247-269 | Basic and acidic residues | ||||
Sequence: DLTSQKHRHTNHELNSLAHSNRQ |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X97719 EMBL· GenBank· DDBJ | CAA66305.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X97720 EMBL· GenBank· DDBJ | CAA66306.1 EMBL· GenBank· DDBJ | Genomic DNA |