P69566 · RANB9_MOUSE
- ProteinRan-binding protein 9
- GeneRanbp9
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids653 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May act as scaffolding protein, and as adapter protein to couple membrane receptors to intracellular signaling pathways. Acts as a mediator of cell spreading and actin cytoskeleton rearrangement. Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1. May be involved in signaling of ITGB2/LFA-1 and other integrins. Enhances HGF-MET signaling by recruiting Sos and activating the Ras pathway. Enhances dihydrotestosterone-induced transactivation activity of AR, as well as dexamethasone-induced transactivation activity of NR3C1, but not affect estrogen-induced transactivation. Stabilizes TP73 isoform Alpha, probably by inhibiting its ubiquitination, and increases its proapoptotic activity. Inhibits the kinase activity of DYRK1A and DYRK1B. Inhibits FMR1 binding to RNA.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Cellular Component | plasma membrane | |
Molecular Function | small GTPase binding | |
Biological Process | cytoskeleton organization | |
Biological Process | positive regulation of amyloid precursor protein catabolic process |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRan-binding protein 9
- Short namesRanBP9
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP69566
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000097170 | 1-653 | Ran-binding protein 9 | |||
Sequence: MSGQPPPPPPQQQPPPPPPPASAAAPATAPPGLAVGPGPAAGVPVPGLAAGSSAAAPFPHGDSALNEQEKELQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTKIQAQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHGMSIHSLAPGKSSTAHFSGFESCSNGVISNKAHQSYCHSKHQLSSLTVPELNSLNVSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDCSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRECGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGVGSCAFATVEDYLH | ||||||
Modified residue | 330 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 402 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 412 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylated in response to stress.
Ubiquitinated. Polyubiquitination targets the protein for rapid degradation via the ubiquitin system (By similarity).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitously expressed, with highest levels in maturating spermatocytes.
Gene expression databases
Interaction
Subunit
Part of a complex consisting of RANBP9, MKLN1 and GID8. Identified in the CTLH complex that contains GID4, RANBP9 and/or RANBP10, MKLN1, MAEA, RMND5A (or alternatively its paralog RMND5B), GID8, ARMC8, WDR26 and YPEL5. Within this complex, MAEA, RMND5A (or alternatively its paralog RMND5B), GID8, WDR26, and RANBP9 and/or RANBP10 form the catalytic core, while GID4, MKLN1, ARMC8 and YPEL5 have ancillary roles. Interacts with GTP-bound Ran, AR, CDC2L1/p110C, CALB1, S100A7, USP11, SOS1 or SOS2, GID8, and FMR1. Interacts with the Dyrk kinases HIPK2, DYRK1A, and DYRK1B. Interacts with TP73 isoform Alpha but not with TP53. Interacts with the HGF receptor MET and the integrins ITGB1 and ITGB2, but not with ITGAL. Part of a complex consisting of RANBP9, RAN, DYRK1B and COPS5. Directly interacts with RANBP10. Interacts with YPEL5 (By similarity).
Interacts with MKLN1 (PubMed:18710924).
Interacts with DDX4 (PubMed:14648869).
Interacts with NGFR (PubMed:12963025).
Interacts with Tex19.1 and, probably, Tex19.2 (PubMed:28254886).
Interacts with MKLN1 (PubMed:18710924).
Interacts with DDX4 (PubMed:14648869).
Interacts with NGFR (PubMed:12963025).
Interacts with Tex19.1 and, probably, Tex19.2 (PubMed:28254886).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P69566 | Lrp1b Q9JI18 | 2 | EBI-772305, EBI-8294317 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-26 | Pro residues | ||||
Sequence: MSGQPPPPPPQQQPPPPPPPASAAAP | ||||||
Region | 1-62 | Disordered | ||||
Sequence: MSGQPPPPPPQQQPPPPPPPASAAAPATAPPGLAVGPGPAAGVPVPGLAAGSSAAAPFPHGD | ||||||
Domain | 72-259 | B30.2/SPRY | ||||
Sequence: LQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPF | ||||||
Domain | 290-322 | LisH | ||||
Sequence: WQTMIQKMVSSYLVHHGYCATAEAFARSTDQTV | ||||||
Region | 326-332 | Interaction with CALB1 | ||||
Sequence: LASIKNR | ||||||
Domain | 328-385 | CTLH | ||||
Sequence: SIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEV | ||||||
Region | 386-422 | Disordered | ||||
Sequence: RCLGGRSPKSQDSYPVSPRPFSSPSMSPSHGMSIHSL | ||||||
Compositional bias | 395-422 | Polar residues | ||||
Sequence: SQDSYPVSPRPFSSPSMSPSHGMSIHSL | ||||||
Region | 539-653 | Interaction with FMR1 | ||||
Sequence: AAIERMIHFGRELQAMSEQLRRECGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGVGSCAFATVEDYLH |
Domain
The SPRY domain mediates the interaction with MET, AR, and CDC2L1.
Sequence similarities
Belongs to the RANBP9/10 family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P69566-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length653
- Mass (Da)71,012
- Last updated2005-03-29 v1
- ChecksumBE810E69B238BBD5
P69566-2
- Name2
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1Y7VP77 | A0A1Y7VP77_MOUSE | Ranbp9 | 37 | ||
A0A1Y7VLX7 | A0A1Y7VLX7_MOUSE | Ranbp9 | 148 | ||
A0A1Y7VLC4 | A0A1Y7VLC4_MOUSE | Ranbp9 | 96 | ||
E9Q5D6 | E9Q5D6_MOUSE | Ranbp9 | 710 | ||
A0A1Y7VIP5 | A0A1Y7VIP5_MOUSE | Ranbp9 | 64 |
Features
Showing features for compositional bias, alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-26 | Pro residues | ||||
Sequence: MSGQPPPPPPQQQPPPPPPPASAAAP | ||||||
Alternative sequence | VSP_028266 | 1-107 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 92 | in Ref. 4 | ||||
Sequence: R → P | ||||||
Alternative sequence | VSP_028267 | 108-115 | in isoform 2 | |||
Sequence: NNLRVHYK → MWESSWVL | ||||||
Compositional bias | 395-422 | Polar residues | ||||
Sequence: SQDSYPVSPRPFSSPSMSPSHGMSIHSL |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF006465 EMBL· GenBank· DDBJ | AAD01272.1 EMBL· GenBank· DDBJ | mRNA | ||
AK132714 EMBL· GenBank· DDBJ | BAE21317.1 EMBL· GenBank· DDBJ | mRNA |