P69201 · RL40_LEIMA
- ProteinUbiquitin-ribosomal protein eL40 fusion protein
- GeneUB-EP52
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids128 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Ubiquitin
Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-48-linked is involved in protein degradation via the proteasome. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling (By similarity).
Large ribosomal subunit protein eL40
Component of the 60S subunit of the ribosome.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Cellular Component | ribonucleoprotein complex | |
Cellular Component | ribosome | |
Molecular Function | protein tag activity | |
Molecular Function | structural constituent of ribosome | |
Molecular Function | ubiquitin protein ligase binding | |
Biological Process | modification-dependent protein catabolic process | |
Biological Process | protein ubiquitination | |
Biological Process | translation |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameUbiquitin-ribosomal protein eL40 fusion protein
- Cleaved into 2 chains
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Discoba > Euglenozoa > Kinetoplastea > Metakinetoplastina > Trypanosomatida > Trypanosomatidae > Leishmaniinae > Leishmania
Accessions
- Primary accessionP69201
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000114825 | 1-76 | Ubiquitin | |||
Sequence: MQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYNIQKESTLHLVLRLRGG | ||||||
Cross-link | 48 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K | ||||||
Cross-link | 76 | Glycyl lysine isopeptide (Gly-Lys) (interchain with K-? in acceptor proteins) | ||||
Sequence: G | ||||||
Chain | PRO_0000138765 | 77-128 | Large ribosomal subunit protein eL40 | |||
Sequence: VMEPTLVALAKKYNWEKKVCRRCYARLPVRATNCRKKACGHCSNLRMKKKLR |
Keywords
- PTM
Interaction
Subunit
Large ribosomal subunit protein eL40
Part of the 60S ribosomal subunit.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-76 | Ubiquitin-like | ||||
Sequence: MQIFVKTLTGKTIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLSDYNIQKESTLHLVLRLRGG |
Sequence similarities
In the N-terminal section; belongs to the ubiquitin family.
In the C-terminal section; belongs to the eukaryotic ribosomal protein eL40 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length128
- Mass (Da)14,682
- Last updated2010-08-10 v2
- Checksum4B46DF6563C3E7FF
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z14232 EMBL· GenBank· DDBJ | CAA78598.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z14232 EMBL· GenBank· DDBJ | CAA78599.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FR796427 EMBL· GenBank· DDBJ | CAJ08378.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FR796427 EMBL· GenBank· DDBJ | CAJ08391.1 EMBL· GenBank· DDBJ | Genomic DNA |