P68510 · 1433F_MOUSE
- Protein14-3-3 protein eta
- GeneYwhah
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids246 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1 (By similarity).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 57 | Interaction with phosphoserine on interacting protein | ||||
Sequence: R | ||||||
Site | 132 | Interaction with phosphoserine on interacting protein | ||||
Sequence: R |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended name14-3-3 protein eta
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP68510
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylglycine | ||||
Sequence: G | ||||||
Chain | PRO_0000058624 | 2-246 | 14-3-3 protein eta | |||
Sequence: GDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN | ||||||
Modified residue | 25 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 59 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylated on Ser-59 by protein kinase C delta type catalytic subunit in a sphingosine-dependent fashion.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Homodimer (By similarity).
Interacts with many nuclear hormone receptors and cofactors including AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP and THRA. Interacts with ABL1 (phosphorylated form); the interaction retains it in the cytoplasm. Weakly interacts with CDKN1B (By similarity).
Interacts with ARHGEF28 and CDK16. Interacts with KCNK18 in a phosphorylation-dependent manner. Interacts with SAMSN1. Interacts with the 'Ser-241' phosphorylated form of PDPK1 (By similarity).
Interacts with the 'Thr-369' phosphorylated form of DAPK2 (PubMed:26047703).
Interacts with PI4KB, TBC1D22A and TBC1D22B (By similarity).
Interacts with SLITRK1 (By similarity).
Interacts with MEFV (By similarity).
Interacts with many nuclear hormone receptors and cofactors including AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP and THRA. Interacts with ABL1 (phosphorylated form); the interaction retains it in the cytoplasm. Weakly interacts with CDKN1B (By similarity).
Interacts with ARHGEF28 and CDK16. Interacts with KCNK18 in a phosphorylation-dependent manner. Interacts with SAMSN1. Interacts with the 'Ser-241' phosphorylated form of PDPK1 (By similarity).
Interacts with the 'Thr-369' phosphorylated form of DAPK2 (PubMed:26047703).
Interacts with PI4KB, TBC1D22A and TBC1D22B (By similarity).
Interacts with SLITRK1 (By similarity).
Interacts with MEFV (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P68510 | Lrrk2 Q5S006 | 7 | EBI-444641, EBI-2693710 | |
BINARY | P68510 | Prkn Q9WVS6 | 2 | EBI-444641, EBI-973635 | |
XENO | P68510 | PRKN O60260 | 6 | EBI-444641, EBI-716346 | |
XENO | P68510 | TNFAIP3 P21580 | 3 | EBI-444641, EBI-527670 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length246
- Mass (Da)28,212
- Last updated2007-01-23 v2
- ChecksumC12F62B4ABA76DA3
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 15-16 | in Ref. 2; BAA13422 | ||||
Sequence: EQ → DE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U57311 EMBL· GenBank· DDBJ | AAC53256.1 EMBL· GenBank· DDBJ | mRNA | ||
D87661 EMBL· GenBank· DDBJ | BAA13422.1 EMBL· GenBank· DDBJ | mRNA | ||
AF077002 EMBL· GenBank· DDBJ | AAC36290.1 EMBL· GenBank· DDBJ | mRNA | ||
AB063572 EMBL· GenBank· DDBJ | BAB79599.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK077596 EMBL· GenBank· DDBJ | BAC36887.1 EMBL· GenBank· DDBJ | mRNA | ||
AK149224 EMBL· GenBank· DDBJ | BAE28768.1 EMBL· GenBank· DDBJ | mRNA | ||
AK168520 EMBL· GenBank· DDBJ | BAE40399.1 EMBL· GenBank· DDBJ | mRNA | ||
AK169035 EMBL· GenBank· DDBJ | BAE40826.1 EMBL· GenBank· DDBJ | mRNA | ||
AK169189 EMBL· GenBank· DDBJ | BAE40965.1 EMBL· GenBank· DDBJ | mRNA | ||
BC008187 EMBL· GenBank· DDBJ | AAH08187.1 EMBL· GenBank· DDBJ | mRNA | ||
BC061497 EMBL· GenBank· DDBJ | AAH61497.1 EMBL· GenBank· DDBJ | mRNA |