P68501 · MTB_ONCMY
- ProteinMetallothionein B
- Genemtb
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Metallothioneins have a high content of cysteine residues that bind various heavy metals.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 4 | a divalent metal cation 1 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 6 | a divalent metal cation 1 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 6 | a divalent metal cation 2 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 12 | a divalent metal cation 2 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 14 | a divalent metal cation 2 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 14 | a divalent metal cation 3 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 18 | a divalent metal cation 3 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 20 | a divalent metal cation 1 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 23 | a divalent metal cation 1 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 23 | a divalent metal cation 3 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 25 | a divalent metal cation 2 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 28 | a divalent metal cation 3 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 32 | a divalent metal cation 4 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 33 | a divalent metal cation 4 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 33 | a divalent metal cation 5 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 35 | a divalent metal cation 5 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 36 | a divalent metal cation 5 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 36 | a divalent metal cation 6 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 40 | a divalent metal cation 6 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 43 | a divalent metal cation 4 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 43 | a divalent metal cation 6 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 47 | a divalent metal cation 4 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 49 | a divalent metal cation 5 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 49 | a divalent metal cation 7 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 54 | a divalent metal cation 7 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 58 | a divalent metal cation 7 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 59 | a divalent metal cation 6 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 59 | a divalent metal cation 7 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | metal ion binding | |
Biological Process | response to cadmium ion | |
Biological Process | response to copper ion | |
Biological Process | response to mercury ion | |
Biological Process | response to zinc ion |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameMetallothionein B
- Short namesMT-B
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Protacanthopterygii > Salmoniformes > Salmonidae > Salmoninae > Oncorhynchus
Accessions
- Primary accessionP68501
- Secondary accessions
Proteomes
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000197296 | 1-60 | Metallothionein B | |||
Sequence: MDPCECSKTGSCNCGGSCKCSNCACTSCKKSCCPCCPSDCSKCASGCVCKGKTCDTSCCQ |
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-28 | Beta | ||||
Sequence: MDPCECSKTGSCNCGGSCKCSNCACTSC | ||||||
Region | 29-60 | Alpha | ||||
Sequence: KKSCCPCCPSDCSKCASGCVCKGKTCDTSCCQ |
Domain
Class I metallothioneins contain 2 metal-binding domains: four divalent ions are chelated within cluster A of the alpha domain and are coordinated via cysteinyl thiolate bridges to 11 cysteine ligands. Cluster B, the corresponding region within the beta domain, can ligate three divalent ions to 9 cysteines.
Sequence similarities
Belongs to the metallothionein superfamily. Type 1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length60
- Mass (Da)6,033
- Last updated2004-11-23 v1
- Checksum9EA1E70FBE59B4EE
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M18104 EMBL· GenBank· DDBJ | AAA49566.1 EMBL· GenBank· DDBJ | mRNA | ||
M22487 EMBL· GenBank· DDBJ | AAA49567.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X59394 EMBL· GenBank· DDBJ | CAA42037.1 EMBL· GenBank· DDBJ | mRNA |