P63277 · AMELX_MOUSE
- ProteinAmelogenin, X isoform
- GeneAmelx
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids210 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in the biomineralization of teeth. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | basement membrane | |
Cellular Component | cell surface | |
Cellular Component | collagen-containing extracellular matrix | |
Cellular Component | endocytic vesicle | |
Cellular Component | extracellular region | |
Cellular Component | protein-containing complex | |
Cellular Component | supramolecular complex | |
Molecular Function | calcium ion binding | |
Molecular Function | growth factor activity | |
Molecular Function | hydroxyapatite binding | |
Molecular Function | identical protein binding | |
Molecular Function | protein homodimerization activity | |
Molecular Function | sodium ion binding | |
Molecular Function | structural constituent of tooth enamel | |
Biological Process | amelogenesis | |
Biological Process | cell adhesion | |
Biological Process | enamel mineralization | |
Biological Process | odontogenesis of dentin-containing tooth | |
Biological Process | regulation of cell population proliferation | |
Biological Process | signal transduction | |
Biological Process | tooth mineralization |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAmelogenin, X isoform
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP63277
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MGTWILFACLLGAAFA | ||||||
Chain | PRO_0000001201 | 17-210 | Amelogenin, X isoform | |||
Sequence: MPLPPHPGSPGYINLSYEKSHSQAINTDRTALVLTPLKWYQSMIRQPYPSYGYEPMGGWLHHQIIPVLSQQHPPSHTLQPHHHLPVVPAQQPVAPQQPMMPVPGHHSMTPTQHHQPNIPPSAQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQPLSPILPELPLEAWPATDKTKREEVD | ||||||
Modified residue | 32 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Several forms are produced by C-terminal processing.
Phosphorylated by FAM20C in vitro.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Developmental stage
Expressed in ameloblasts at the periphery of mandibular molars at P1 (PubMed:12657653).
At P3 also expressed at the molar incisal region (PubMed:12657653).
Expressed at the terminal of Tomes' processes of ameloblasts at the incisal region at P5 (PubMed:12657653).
At P3 also expressed at the molar incisal region (PubMed:12657653).
Expressed at the terminal of Tomes' processes of ameloblasts at the incisal region at P5 (PubMed:12657653).
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 109-187 | Disordered | ||||
Sequence: VAPQQPMMPVPGHHSMTPTQHHQPNIPPSAQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQPLS | ||||||
Compositional bias | 138-185 | Pro residues | ||||
Sequence: AQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQP |
Sequence similarities
Belongs to the amelogenin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 4 isoforms produced by Alternative splicing. Additional isoforms seem to exist.
P63277-4
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name4
- Length210
- Mass (Da)23,483
- Last updated2004-10-11 v1
- ChecksumEB6ED5D09AA83AFA
P63277-1
- Name1
- Differences from canonical
- 35-48: Missing
P63277-2
- Name2
- SynonymsLRAP
P63277-3
- Name3
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q6PCW7 | Q6PCW7_MOUSE | Amelx | 219 |
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_011688 | 35-48 | in isoform 1, isoform 2 and isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_000231 | 64-87 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_000230 | 64-184 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 111 | in Ref. 6; AAA37218 | ||||
Sequence: P → A | ||||||
Compositional bias | 138-185 | Pro residues | ||||
Sequence: AQQPFQQPFQPQAIPPQSHQPMQPQSPLHPMQPLAPQPPLPPLFSMQP |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D31768 EMBL· GenBank· DDBJ | BAA06546.1 EMBL· GenBank· DDBJ | mRNA | ||
D31769 EMBL· GenBank· DDBJ | BAA06547.1 EMBL· GenBank· DDBJ | mRNA | ||
D83067 EMBL· GenBank· DDBJ | BAA23665.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK029358 EMBL· GenBank· DDBJ | BAC26415.1 EMBL· GenBank· DDBJ | mRNA | ||
AL805974 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
M10095 EMBL· GenBank· DDBJ | AAA37218.1 EMBL· GenBank· DDBJ | mRNA |