P63044 · VAMP2_MOUSE
- ProteinVesicle-associated membrane protein 2
- GeneVamp2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids116 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the targeting and/or fusion of transport vesicles to their target membrane (PubMed:9430681).
Major SNARE protein of synaptic vesicles which mediates fusion of synaptic vesicles to release neurotransmitters. Essential for fast vesicular exocytosis and activity-dependent neurotransmitter release as well as fast endocytosis that mediates rapid reuse of synaptic vesicles (PubMed:15475946).
Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 (By similarity).
Major SNARE protein of synaptic vesicles which mediates fusion of synaptic vesicles to release neurotransmitters. Essential for fast vesicular exocytosis and activity-dependent neurotransmitter release as well as fast endocytosis that mediates rapid reuse of synaptic vesicles (PubMed:15475946).
Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 (By similarity).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 76-77 | (Microbial infection) Cleavage; by C.botulinum neurotoxin type B (BoNT/B, botB) | ||||
Sequence: QF | ||||||
Site | 76-77 | (Microbial infection) Cleavage; by C.tetani neurotoxin (tetX) | ||||
Sequence: QF |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameVesicle-associated membrane protein 2
- Short namesVAMP-2
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP63044
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane ; Single-pass type IV membrane protein
Note: Colocalizes with PRKCZ and WDFY2 in intracellular vesicles.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 2-94 | Cytoplasmic | ||||
Sequence: SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK | ||||||
Transmembrane | 95-114 | Helical; Anchor for type IV membrane protein | ||||
Sequence: MMIILGVICAIILIIIIVYF | ||||||
Topological domain | 115-116 | Vesicular | ||||
Sequence: ST |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylserine | ||||
Sequence: S | ||||||
Chain | PRO_0000206725 | 2-116 | Vesicle-associated membrane protein 2 | |||
Sequence: SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST |
Post-translational modification
Phosphorylated by PRKCZ in vitro and this phosphorylation is increased in the presence of WDFY2.
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type B (BoNT/B, botB); 20 hours after treatment of spinal cord cells almost all the protein has been digested (PubMed:10413679).
BoNT/B hydrolyzes the 76-Gln-|-Phe-77 bond and inhibits neurotransmitter release (Probable)
BoNT/B hydrolyzes the 76-Gln-|-Phe-77 bond and inhibits neurotransmitter release (Probable)
(Microbial infection) Targeted and hydrolyzed by C.tetani toxin (tetX); 20 hours after treatment of spinal cord cells almost all the protein has been digested (PubMed:10413679).
Tetanus toxin hydrolyzes the 76-Gln-|-Phe-77 bond and inhibits neurotransmitter release (Probable)
Tetanus toxin hydrolyzes the 76-Gln-|-Phe-77 bond and inhibits neurotransmitter release (Probable)
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the outer plexiform layer of the retina (at protein level).
Gene expression databases
Interaction
Subunit
Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A; this complex constitutes the basic catalytic machinery of the complex neurotransmitter release apparatus (PubMed:19196426, PubMed:28821673).
Recruited to the SNARE complex following binding of the SNARE complex component STX1A to STXBP1 (PubMed:28821673).
This complex binds to CPLX1. Interacts with VAPA and VAPB (By similarity).
Interacts (via N-terminus) with KCNB1 (via N-terminus and C-terminus); stimulates the channel inactivation rate of KCNB1 (By similarity).
Interacts with BVES and STX4. Interacts with WDFY2, PRKCZ and PRKCI (PubMed:17313651).
Forms a complex with WDFY2 and PRKCZ (PubMed:17313651).
Interacts with SEPT8; the interaction inhibits interaction of VAMP2 with SYP (PubMed:19196426).
Interacts with SYP; the interaction is inhibited by interaction with SEPT8 (PubMed:19196426).
Interacts with PICALM (By similarity).
Interacts with alpha-synuclein/SNCA. Interacts with STX3 isoform 3B (PubMed:26406599).
Recruited to the SNARE complex following binding of the SNARE complex component STX1A to STXBP1 (PubMed:28821673).
This complex binds to CPLX1. Interacts with VAPA and VAPB (By similarity).
Interacts (via N-terminus) with KCNB1 (via N-terminus and C-terminus); stimulates the channel inactivation rate of KCNB1 (By similarity).
Interacts with BVES and STX4. Interacts with WDFY2, PRKCZ and PRKCI (PubMed:17313651).
Forms a complex with WDFY2 and PRKCZ (PubMed:17313651).
Interacts with SEPT8; the interaction inhibits interaction of VAMP2 with SYP (PubMed:19196426).
Interacts with SYP; the interaction is inhibited by interaction with SEPT8 (PubMed:19196426).
Interacts with PICALM (By similarity).
Interacts with alpha-synuclein/SNCA. Interacts with STX3 isoform 3B (PubMed:26406599).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P63044 | Cdc42 P60766 | 2 | EBI-521920, EBI-81763 | |
BINARY | P63044 | Snap25 P60879 | 18 | EBI-521920, EBI-445270 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-28 | Disordered | ||||
Sequence: MSATAATVPPAAPAGEGGPPAPPPNLTS | ||||||
Domain | 31-91 | v-SNARE coiled-coil homology | ||||
Sequence: RLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWK | ||||||
Region | 92-116 | Required for interaction with SEPT8 | ||||
Sequence: NLKMMIILGVICAIILIIIIVYFST |
Sequence similarities
Belongs to the synaptobrevin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length116
- Mass (Da)12,691
- Last updated2007-01-23 v2
- Checksum4A0D0D56B5409D0A
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
B0QZN5 | B0QZN5_MOUSE | Vamp2 | 163 | ||
A0AA74KTG8 | A0AA74KTG8_MOUSE | Vamp2 | 43 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U60150 EMBL· GenBank· DDBJ | AAB03463.1 EMBL· GenBank· DDBJ | mRNA | ||
AK090178 EMBL· GenBank· DDBJ | BAC41125.1 EMBL· GenBank· DDBJ | mRNA | ||
BC055105 EMBL· GenBank· DDBJ | AAH55105.1 EMBL· GenBank· DDBJ | mRNA |