P63030 · MPC1_MOUSE
- ProteinMitochondrial pyruvate carrier 1
- GeneMpc1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids109 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Mediates the uptake of pyruvate into mitochondria.
Catalytic activity
- H+(out) + pyruvate(out) = H+(in) + pyruvate(in)
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrion | |
Molecular Function | pyruvate transmembrane transporter activity | |
Biological Process | acetyl-CoA biosynthetic process from pyruvate | |
Biological Process | cellular response to leukemia inhibitory factor | |
Biological Process | mitochondrial pyruvate transmembrane transport |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMitochondrial pyruvate carrier 1
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP63030
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 2-20 | Mitochondrial matrix | ||||
Sequence: AGALVRKAADYVRSKDFRD | ||||||
Transmembrane | 21-41 | Helical | ||||
Sequence: YLMSTHFWGPVANWGLPIAAI | ||||||
Topological domain | 42-52 | Mitochondrial intermembrane | ||||
Sequence: NDMKKSPEIIS | ||||||
Transmembrane | 53-71 | Helical | ||||
Sequence: GRMTFALCCYSLTFMRFAY | ||||||
Topological domain | 72-109 | Mitochondrial matrix | ||||
Sequence: KVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA |
Keywords
- Cellular component
Phenotypes & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 7 variants from UniProt as well as other sources including ClinVar and dbSNP.
Chemistry
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000212798 | 2-109 | Mitochondrial pyruvate carrier 1 | |||
Sequence: AGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA | ||||||
Modified residue | 72 | N6-acetyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length109
- Mass (Da)12,455
- Last updated2004-08-31 v1
- ChecksumE0536878BAA68124
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 64 | in Ref. 2; BAB29340 | ||||
Sequence: L → Q |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF181116 EMBL· GenBank· DDBJ | AAF25816.1 EMBL· GenBank· DDBJ | mRNA | ||
AK002241 EMBL· GenBank· DDBJ | BAB21958.1 EMBL· GenBank· DDBJ | mRNA | ||
AK002266 EMBL· GenBank· DDBJ | BAB21976.1 EMBL· GenBank· DDBJ | mRNA | ||
AK004013 EMBL· GenBank· DDBJ | BAB23124.1 EMBL· GenBank· DDBJ | mRNA | ||
AK013391 EMBL· GenBank· DDBJ | BAB28826.1 EMBL· GenBank· DDBJ | mRNA | ||
AK014421 EMBL· GenBank· DDBJ | BAB29340.1 EMBL· GenBank· DDBJ | mRNA | ||
BC024365 EMBL· GenBank· DDBJ | AAH24365.1 EMBL· GenBank· DDBJ | mRNA |